DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dus2 and AT4G38890

DIOPT Version :10

Sequence 1:NP_572950.2 Gene:Dus2 / 32377 FlyBaseID:FBgn0030554 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_195600.2 Gene:AT4G38890 / 830044 AraportID:AT4G38890 Length:691 Species:Arabidopsis thaliana


Alignment Length:270 Identity:73/270 - (27%)
Similarity:126/270 - (46%) Gaps:31/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILRKSFSMKTRQR-----LDYRNKLILAPMVRVGTLPMRLLALEMGADIVYTEELVDIKLIKSIR 66
            |:....|:|...|     :|:|:||.|||:..||.||.|.|...:|||:...|..:...|::.  
plant   316 IVETDSSLKLHPREKKKLIDFRDKLYLAPLTTVGNLPFRRLCKVLGADVTCGEMAMCTNLLQG-- 378

  Fly    67 RPNPALGTVDFVDPSDGTIVFRTCAQETSRLVLQMGTSDAGRALAVGKLLQRD--ISGLDINMGC 129
                        ..|:..::.|..:::.  ..:|:..|.......|.:|:.|:  :..:||||||
plant   379 ------------QASEWALLRRHSSEDL--FGVQICGSYPDTVSRVVELIDRECTVDFIDINMGC 429

  Fly   130 PKEFSIKGGMGAALLADPDKAAHILRTLCSGLDIPVTCKIR-ILPDVEGTID-LVQKLAATGIAA 192
            |.:..:....|:|||..|.:..:|:....|.::.|:|.|:| ...:.:..|| |:..:...|..|
plant   430 PIDMVVNKSAGSALLNKPLRMKNIVEVSSSIVETPITIKVRTAFFEGKNRIDSLIADIGNWGATA 494

  Fly   193 IGIHARTRDERPQHPAHPEVLRAVAQ--AVDIPIIANGGSKNMHCYDDLRKFQMEC-GADSVMVA 254
            :.||.|:|.:|....|..:.:....:  ..::.:|.||   :::.|.|..|.:.:| ...|.|:|
plant   495 VTIHGRSRQQRYSKSADWDYIYQCTKNATTNLQVIGNG---DVYSYLDWNKHKSDCPELSSCMIA 556

  Fly   255 RAAQINVSIF 264
            |.|.|...||
plant   557 RGALIKPWIF 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dus2NP_572950.2 DUS_like_FMN 25..266 CDD:239200 67/247 (27%)
DSRM_DUS2L 394..458 CDD:380700
AT4G38890NP_195600.2 DUS_like_FMN 339..574 CDD:239200 67/247 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.