DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1434 and AT3G49640

DIOPT Version :9

Sequence 1:NP_001285237.1 Gene:CG1434 / 32377 FlyBaseID:FBgn0030554 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_190533.3 Gene:AT3G49640 / 824126 AraportID:AT3G49640 Length:329 Species:Arabidopsis thaliana


Alignment Length:314 Identity:143/314 - (45%)
Similarity:203/314 - (64%) Gaps:5/314 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LDYRNKLILAPMVRVGTLPMRLLALEMGADIVYTEELVDIKLIKSIRRPNPALGTVDFVDPSDGT 84
            :||:|||:||||||||||..|:||.|.||||.|.||::|.||:|..||.|.|.||.:||:.....
plant     1 MDYQNKLVLAPMVRVGTLSFRMLAAEYGADITYGEEIIDHKLVKCERRLNVASGTSEFVEKGTDN 65

  Fly    85 IVFRTCAQETSRLVLQMGTSDAGRALAVGKLLQRDISGLDINMGCPKEFSIKGGMGAALLADPDK 149
            :||.||.:|.||:|.|||||||.|||...:::..|::.:||||||||.|||:||||||||:.|:.
plant    66 VVFSTCDEEKSRVVFQMGTSDAVRALKASEIVCNDVATIDINMGCPKAFSIQGGMGAALLSKPEL 130

  Fly   150 AAHILRTLCSGLDIPVTCKIRILPDVEGTIDLVQKLAATGIAAIGIHARTRDERPQHPAHPEVLR 214
            ...||.||...||:|||||||:|.....|::|.:::...|:.|:.:|.|...:||:.||..:.:.
plant   131 IHDILATLKRNLDVPVTCKIRLLKSPADTVELARRIEKLGVPALAVHGRKIADRPRDPAKWDEIA 195

  Fly   215 AVAQAVDIPIIANGGSKNMHCYDDLRKFQMECGADSVMVARAAQINVSIFRPEGLLPMDELIEKY 279
            .|..|:.||:||||   ::..|||..:.:...||.||||||.|..|.|||.|:|....:::.:||
plant   196 DVVAALSIPVIANG---DVLEYDDFSRIKTATGAASVMVARGAMWNASIFSPKGKSHWEDVKKKY 257

  Fly   280 LRLCVDYDNAPHNAKYCVQSIL--RELQETPRGKRFLQCQTLQQICEIWELGDY 331
            ||..:.::|...:.||.::.::  ....|.|.||...:..||:.:..:::|.||
plant   258 LRKSILWNNDVKSTKYTIKEMIAHHSCLELPEGKSINKADTLEDLARLYDLEDY 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1434NP_001285237.1 DusA 14..287 CDD:223120 131/266 (49%)
DUS_like_FMN 25..266 CDD:239200 122/240 (51%)
Rnc <317..461 CDD:223644 5/15 (33%)
DSRM 395..457 CDD:238007
AT3G49640NP_190533.3 DusA 1..>242 CDD:223120 123/243 (51%)
DUS_like_FMN 6..250 CDD:239200 124/246 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 228 1.000 Domainoid score I666
eggNOG 1 0.900 - - E1_COG0042
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6838
Inparanoid 1 1.050 273 1.000 Inparanoid score I906
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D801857at2759
OrthoFinder 1 1.000 - - FOG0004414
OrthoInspector 1 1.000 - - oto2909
orthoMCL 1 0.900 - - OOG6_102617
Panther 1 1.100 - - LDO PTHR45936
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3701
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.