DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1434 and Dus4l

DIOPT Version :9

Sequence 1:NP_001285237.1 Gene:CG1434 / 32377 FlyBaseID:FBgn0030554 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_082278.1 Gene:Dus4l / 71916 MGIID:1919166 Length:324 Species:Mus musculus


Alignment Length:242 Identity:78/242 - (32%)
Similarity:127/242 - (52%) Gaps:25/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILAPMVRVGTLPMRLLALEMGADIVYTEELVDIKLIKSIRRPNPALGTVDFVDPSDGTIVFRTCA 91
            :.|||||...|..|.|..:...|:.||..::....::||:..:...                |..
Mouse    30 VCAPMVRYSKLAFRTLVRKYSCDLCYTPMIIAADFVRSIKARDSEF----------------TTN 78

  Fly    92 QETSRLVLQMGTSDAGRALAVGKLLQRD-ISGLDINMGCPKEFSIKGGMGAALLADPDKAAHILR 155
            |....|::|...:|| |.|:...||... .:|:|||.|||:.:::..|.||.|:..|:....::|
Mouse    79 QGDCPLIVQFAANDA-RLLSDAALLVCPYANGIDINCGCPQRWAMADGYGACLINKPELVHDMVR 142

  Fly   156 TLCSGLDIP---VTCKIRILPDVEGTIDLVQKLAATGIAAIGIHARTRDERPQHPAHPEVLRAVA 217
            .:.:.::.|   |:.||||..|:..||||.:|..|||::.|.:|.||.:||.| |.|.:.::.:.
Mouse   143 QVRNRVESPRFSVSIKIRIHDDLARTIDLCRKAEATGVSWITVHGRTVEERHQ-PVHYDAIKMIK 206

  Fly   218 QAVDIPIIANGGSKNMHCYDDLRKFQMECGADSVMVARAAQINVSIF 264
            :.|.|||:|||..:::...:::  :|| .|.|.|||||....|.::|
Mouse   207 ENVSIPIVANGDIRSLKEAENV--WQM-TGTDGVMVARGLLTNPAMF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1434NP_001285237.1 DusA 14..287 CDD:223120 78/242 (32%)
DUS_like_FMN 25..266 CDD:239200 78/242 (32%)
Rnc <317..461 CDD:223644
DSRM 395..457 CDD:238007
Dus4lNP_082278.1 DUS_like_FMN 28..257 CDD:239200 78/242 (32%)
DusA 32..311 CDD:223120 78/240 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.