DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1434 and DUS3L

DIOPT Version :9

Sequence 1:NP_001285237.1 Gene:CG1434 / 32377 FlyBaseID:FBgn0030554 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_064560.2 Gene:DUS3L / 56931 HGNCID:26920 Length:650 Species:Homo sapiens


Alignment Length:372 Identity:94/372 - (25%)
Similarity:155/372 - (41%) Gaps:71/372 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RQRLDYRNKLILAPMVRVGTLPMRLLALEMGADIVYTEELVDIKLIKSIRRPNPALGTVDFVDPS 81
            ::|||.|.||.|||:...|.||.|.:....|||:...|..|...|::.              ..|
Human   298 KKRLDIRGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQG--------------QMS 348

  Fly    82 DGTIVFRTCAQETSRLVLQMGTSDAGRALAVGKLLQR--DISGLDINMGCPKEFSIKGGMGAALL 144
            :..::.|...::...:.|:....|.....|  :||.|  ::..:|||:|||.:...|.|.|.||:
Human   349 EWALLKRHQCEDIFGVQLEGAFPDTMTKCA--ELLSRTVEVDFVDINVGCPIDLVYKKGGGCALM 411

  Fly   145 ADPDKAAHILRTLCSGLDIPVTCKIRILPDVEGTIDLVQKLAAT----GIAAIGIHARTRDERPQ 205
            ....|...|:|.:...||:|:|.|||  ..|:..::|..:|...    |:|.:.:|.|:|::|..
Human   412 NRSTKFQQIVRGMNQVLDVPLTVKIR--TGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYT 474

  Fly   206 HPAHPEVLRAVAQAVD-IPIIANGGSKNMHCYDDLRKFQMECGADSVMVARAAQINVSIFRPEGL 269
            ..|..:.:....||.. :|:..||   ::..::|..: .|:.|...:|:||.|.:...:|     
Human   475 KLADWQYIEECVQAASPMPLFGNG---DILSFEDANR-AMQTGVTGIMIARGALLKPWLF----- 530

  Fly   270 LPMDELIE---------KYLRLCVDYDNAPHNAKYCVQSILRELQETPRGKRFLQCQTLQQICEI 325
               .|:.|         :.|.:..|:.|      |.::....:.|...:.:||| .:.|..:|..
Human   531 ---TEIKEQRHWDISSSERLDILRDFTN------YGLEHWGSDTQGVEKTRRFL-L
EWLSFLCRY 585

  Fly   326 WELGDYCRRKQRELKTMGNSGRAEVEPP--------EALAKRQKLED 364
            ..:|...|..|          |....||        |.|...||..|
Human   586 VPVGLLERLPQ----------RINERPPYYLGRDYLETLMASQKAAD 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1434NP_001285237.1 DusA 14..287 CDD:223120 75/285 (26%)
DUS_like_FMN 25..266 CDD:239200 67/247 (27%)
Rnc <317..461 CDD:223644 13/56 (23%)
DSRM 395..457 CDD:238007
DUS3LNP_064560.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..120
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 235..284
DusA 297..576 CDD:223120 81/314 (26%)
DUS_like_FMN 306..538 CDD:239200 69/261 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.