DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1434 and dus4l

DIOPT Version :9

Sequence 1:NP_001285237.1 Gene:CG1434 / 32377 FlyBaseID:FBgn0030554 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001003490.2 Gene:dus4l / 445096 ZFINID:ZDB-GENE-040801-233 Length:307 Species:Danio rerio


Alignment Length:241 Identity:72/241 - (29%)
Similarity:114/241 - (47%) Gaps:23/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILAPMVRVGTLPMRLLALEMGADIVYTEELVDIKLIKSIRRPNPALGTVDFVDPSDGTIVFRTCA 91
            :.|||||...|..|.|..:...|:.:|                |.:...||:..:.......|..
Zfish    19 VCAPMVRYSKLAFRTLVRKYDCDVCFT----------------PMIIAADFMRSAKARDSEFTTN 67

  Fly    92 QETSRLVLQMGTSDAGRALAVGKLLQRDISGLDINMGCPKEFSIKGGMGAALLADPDKAAHILRT 156
            :....|::|....||........::.....|:|:|.|||:.:::..|.||.|:..|:....::|.
Zfish    68 KNDRPLIVQFAAKDAQTLADAACVVSPFSDGVDLNCGCPQRWAMSEGYGACLINKPELVKDMVRH 132

  Fly   157 LCSGLDIP---VTCKIRILPDVEGTIDLVQKLAATGIAAIGIHARTRDERPQHPAHPEVLRAVAQ 218
            :.:.:|.|   |:.||||..||..|:||.||:.|.|::.|.:|.||..||.| |.|.:.::.:..
Zfish   133 VRNQIDNPNYAVSIKIRIHKDVRQTVDLCQKVEAAGVSYITVHGRTAIERHQ-PVHYDTIKTIKD 196

  Fly   219 AVDIPIIANGGSKNMHCYDDLRKFQMECGADSVMVARAAQINVSIF 264
            ::.||:||||..|:|   .|:.......|.|.||.||....|.::|
Zfish   197 SLSIPVIANGDIKSM---QDVEAVCELTGVDGVMSARGLLSNPAMF 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1434NP_001285237.1 DusA 14..287 CDD:223120 72/241 (30%)
DUS_like_FMN 25..266 CDD:239200 72/241 (30%)
Rnc <317..461 CDD:223644
DSRM 395..457 CDD:238007
dus4lNP_001003490.2 DusA 15..300 CDD:223120 72/241 (30%)
DUS_like_FMN 19..246 CDD:239200 72/241 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.