DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1434 and dus3l

DIOPT Version :9

Sequence 1:NP_001285237.1 Gene:CG1434 / 32377 FlyBaseID:FBgn0030554 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_012819922.1 Gene:dus3l / 394959 XenbaseID:XB-GENE-943237 Length:645 Species:Xenopus tropicalis


Alignment Length:258 Identity:75/258 - (29%)
Similarity:125/258 - (48%) Gaps:35/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RQRLDYRNKLILAPMVRVGTLPMRLLALEMGADIVYTEELVDIKLIKSIRRPNPALGTVDFVDPS 81
            ::.:|:||||.|||:...|.||.|.|....||||...|..:...|::.              .||
 Frog   293 KKTIDFRNKLYLAPLTTCGNLPFRRLCKRFGADITCGEMAMCTNLLQG--------------QPS 343

  Fly    82 DGTIVFRTCAQETSRLVLQMGTSDAGRALAVGKLLQR--DISGLDINMGCPKEFSIKGGMGAALL 144
            :..::.|..:::...:.|:....|.....|  :||.|  |:..:|||:|||.:...|.|.|..|:
 Frog   344 EWALLKRHHSEDIFGVQLEGAFPDTMTKCA--ELLNRTIDVDFVDINVGCPIDLVYKKGGGCGLM 406

  Fly   145 ADPDKAAHILRTLCSGLDIPVTCKIRILPDVEGTIDLVQKLAAT----GIAAIGIHARTRDERPQ 205
            ...:|...|::.:.|.||:|:|.|||  ..|:..|::..||...    |::.:.:|.|:|::|..
 Frog   407 NRTNKFEQIVKGMNSVLDVPLTVKIR--TGVQEKINIAHKLIPNLRDWGVSLVTLHGRSREQRYT 469

  Fly   206 HPAHPEVLRAVAQAVDI----PIIANGGSKNMHCYDDLRKFQMECGADSVMVARAAQINVSIF 264
            ..|..|.   :||..||    |:..||   ::..|:|..: .::.|...:|:||.|.:...:|
 Frog   470 KLADWEY---IAQCADIASPLPLFGNG---DIISYEDANR-ALQTGVSGIMLARGALLKPWLF 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1434NP_001285237.1 DusA 14..287 CDD:223120 75/258 (29%)
DUS_like_FMN 25..266 CDD:239200 72/250 (29%)
Rnc <317..461 CDD:223644
DSRM 395..457 CDD:238007
dus3lXP_012819922.1 DusA 296..571 CDD:223120 75/255 (29%)
DUS_like_FMN 301..533 CDD:239200 72/250 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.