DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1434 and Dus4l

DIOPT Version :9

Sequence 1:NP_001285237.1 Gene:CG1434 / 32377 FlyBaseID:FBgn0030554 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_038968553.1 Gene:Dus4l / 366593 RGDID:1311445 Length:350 Species:Rattus norvegicus


Alignment Length:272 Identity:82/272 - (30%)
Similarity:136/272 - (50%) Gaps:34/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRLPTILRKSFSMKTRQRLDYRNKLILAPMVRVGT----LPMRLLALEMGADIVYTEELVDIKL 61
            |:|...:|:...|...|     |.|:.:.|.....|    |..|.|..:...|:.||..:|....
  Rat    34 MVRYSNLLKLLLSCSFR-----REKIYVRPFSSSFTADSRLAFRTLVRKYSCDLCYTPMIVAADF 93

  Fly    62 IKSIRRPNPALGTVDFVDPSDGTIVFRTCAQETSRLVLQMGTSDAGRALAVGKLLQRD-ISGLDI 125
            ::|::..:...                |..|....|::|...:|| |.|:...|:... .||:||
  Rat    94 VRSVKARDSEF----------------TTNQGDCPLIVQFAANDA-RLLSDAALIVCPYASGIDI 141

  Fly   126 NMGCPKEFSIKGGMGAALLADPDKAAHILRTLCSGLDIP---VTCKIRILPDVEGTIDLVQKLAA 187
            |.|||:.:::..|.||.|:..|:....::|.:.:.::.|   |:.||||..|:..||||.:|:.|
  Rat   142 NCGCPQRWAMADGYGACLINKPELVLDMVRQVRNRVENPRFSVSIKIRIHDDLARTIDLCRKVEA 206

  Fly   188 TGIAAIGIHARTRDERPQHPAHPEVLRAVAQAVDIPIIANGGSKNMHCYDDLRKFQMECGADSVM 252
            ||::.|.:|.||.:||.| |.|.:.::.:.:.|.|||:|||..:::...:::  :|| .|.|.||
  Rat   207 TGVSWITVHGRTVEERHQ-PVHYDAIKMIKENVSIPIVANGDIRSLKEAENV--WQM-TGTDGVM 267

  Fly   253 VARAAQINVSIF 264
            |||....|.::|
  Rat   268 VARGLLANPAMF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1434NP_001285237.1 DusA 14..287 CDD:223120 78/259 (30%)
DUS_like_FMN 25..266 CDD:239200 76/248 (31%)
Rnc <317..461 CDD:223644
DSRM 395..457 CDD:238007
Dus4lXP_038968553.1 DUS_like_FMN 28..286 CDD:239200 82/272 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.