DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1434 and CG10463

DIOPT Version :9

Sequence 1:NP_001285237.1 Gene:CG1434 / 32377 FlyBaseID:FBgn0030554 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_610000.1 Gene:CG10463 / 35264 FlyBaseID:FBgn0032819 Length:604 Species:Drosophila melanogaster


Alignment Length:378 Identity:89/378 - (23%)
Similarity:157/378 - (41%) Gaps:80/378 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LDYRNKLILAPMVRVGTLPMRLLALEMGADIVYTEELVDIKLIKSI-------RRPNPALGTVDF 77
            :|:|.||:|:|:..:|.||.|.:..|.||||...|......|:|.:       :|          
  Fly   253 VDFREKLVLSPLTTLGNLPFRRICKEFGADITCGEMACAQPLLKGMGQEWALTKR---------- 307

  Fly    78 VDPSDGTIVFRTCAQETSRLVLQMGTSDAGRALAVGKLLQRDISGLDINMGCPKEFSIKGGMGAA 142
             ..|:.....:.|....:.|      :.|  |..:.:..|.|.  :|:|:|||.:...:.|.|:|
  Fly   308 -HQSEDVFGVQLCGNNPNML------NQA--AQVIHETAQVDF--IDLNIGCPIDLIYQQGGGSA 361

  Fly   143 LLADPDKAAHILRTL---CSGLD--IPVTCKIR--ILPDVEGTIDLVQKLAATGIAAIGIHARTR 200
            |:    :..:||...   |:.|.  :|.|.|:|  |..|.....:|:..:...|.:|:.:|.|:|
  Fly   362 LM----RRTNILELTVRSCAALSDRLPFTVKMRTGIYADKSVAHELLPLVEEWGASAVTLHGRSR 422

  Fly   201 DER-PQHPAHPEVLRAVAQAVDIPIIANGGSKNMHCYDD-LRKFQMECGADSVMVARAAQINVSI 263
            ::| .:|.....:....|:|..:|:|.||   ::..|:| :.:..:.....|||:.|.|.|...|
  Fly   423 EQRYTKHANWAYIEECAAKAKCMPVIGNG---DILSYEDYMERRTLAPHVCSVMIGRGALIKPWI 484

  Fly   264 FR----PEGLLPMD----ELIEKYLRLCVDYDNAPHNAKYCVQSILRE------------LQETP 308
            |:    .:...|..    |:::|:....:::..:........:..|.|            ||..|
  Fly   485 FQEIKEKQAWSPSSGQRYEMLQKFCNYGLEHWGSDTKGVETTRRFLLEWQSFLYRYIPEALQTAP 549

  Fly   309 RGKRFLQCQTLQQICEIWELGDYCRRKQRELKTMGNSGRAE--VEPPEALAKR 359
            ..|...:.|..              |.:.|::|:.:||.|.  |:..|:|..|
  Fly   550 PQKINARPQKY--------------RGRDEMETLMSSGNAADWVKLSESLLGR 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1434NP_001285237.1 DusA 14..287 CDD:223120 72/290 (25%)
DUS_like_FMN 25..266 CDD:239200 67/260 (26%)
Rnc <317..461 CDD:223644 11/45 (24%)
DSRM 395..457 CDD:238007
CG10463NP_610000.1 DusA 253..547 CDD:223120 75/321 (23%)
DUS_like_FMN 258..492 CDD:239200 67/261 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464256
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.