DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1434 and CG10495

DIOPT Version :9

Sequence 1:NP_001285237.1 Gene:CG1434 / 32377 FlyBaseID:FBgn0030554 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_609939.1 Gene:CG10495 / 35179 FlyBaseID:FBgn0032750 Length:396 Species:Drosophila melanogaster


Alignment Length:351 Identity:87/351 - (24%)
Similarity:147/351 - (41%) Gaps:65/351 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILAPMVRVGTLPMRLLALEMGADIVYTEELVDIKLIKSIR-RPNPALGTVDFVDPSDGTIVFRTC 90
            :.|||||...|..|.|....|..:.:|..::...:..|.: |.|.                |.|.
  Fly    26 VSAPMVRYSKLEFRRLVRLNGVQLAFTPMMISDSINNSEKARQNE----------------FSTG 74

  Fly    91 AQETSRLVLQMGTSDAGRALAVGKLLQRDISGLDINMGCPKEFSIKGGMGAALLADPDKAAHIL- 154
            |.: ..|:.|....|....:...:|:...:.|:|:|.|||:.:::..|.|..:|..|:....:: 
  Fly    75 ADD-QPLIAQFAAKDPTEFVTSAQLIYPYVDGIDLNCGCPQSWAMAKGYGCGMLRQPELVHQVVQ 138

  Fly   155 ---RTLCSGLDIPVTCKIRIL---PDVEGTIDLVQKLAATGIAAIGIHARTRDERPQH-----PA 208
               |||..  |..|:.|:|:|   ..::.||||.::|.:.|:..:.:|.||..::...     ||
  Fly   139 EVRRTLPG--DFSVSVKMRLLGGEESLQRTIDLARQLESAGVTFLTLHGRTPAQKHSKDTLDIPA 201

  Fly   209 HPEVLRAVAQAVDIPIIANGGSKNMHCYDDLRKFQMECGADSVMVARAAQINVSIFR---PEGLL 270
                :..|.|::.||:|.||   |:..|.|......:.||..||.||....|.::|.   |:|..
  Fly   202 ----MSQVRQSLQIPLIVNG---NVESYRDACDMHEQTGAAGVMAARGLLANPALFNSNYPDGKT 259

  Fly   271 PMDELIEKYLRLCVDYDNAPHNAKY-CVQSILRELQETPRGKRFLQCQ-----TLQQICEIWELG 329
            .....::::|.:.   ..|..|..: |....| ....:.:.||.|:.|     :.:|:.:.    
  Fly   260 TPLSCVQQWLDIA---SAAGDNLLFQCFHHHL-TFMYSAQMKRDLRVQFNSLGSKEQVVDF---- 316

  Fly   330 DYCRRKQRELKTMGNSGRAEVEPPEA 355
                     ||...|...:||:||.|
  Fly   317 ---------LKEHYNLEYSEVDPPSA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1434NP_001285237.1 DusA 14..287 CDD:223120 70/275 (25%)
DUS_like_FMN 25..266 CDD:239200 67/254 (26%)
Rnc <317..461 CDD:223644 10/44 (23%)
DSRM 395..457 CDD:238007
CG10495NP_609939.1 DUS_like_FMN 26..251 CDD:239200 66/250 (26%)
Dus 28..321 CDD:279540 81/335 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464252
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.