DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1434 and CG3645

DIOPT Version :9

Sequence 1:NP_001285237.1 Gene:CG1434 / 32377 FlyBaseID:FBgn0030554 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001259809.1 Gene:CG3645 / 33190 FlyBaseID:FBgn0031238 Length:505 Species:Drosophila melanogaster


Alignment Length:482 Identity:124/482 - (25%)
Similarity:203/482 - (42%) Gaps:100/482 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YRNKL-----ILAPMVRVGTLPMRLLALEMGADIVYTEELVDIKLIKSIRRPNPALGTVDFVDPS 81
            ||:.|     ::||||....|..|:|....||::.|: .:....|..:              ||.
  Fly    21 YRSSLGSPRYVVAPMVDQSELAWRMLCRRYGAELCYS-PMYHANLFAT--------------DPK 70

  Fly    82 DGTIVFRTCAQETSRLVLQMGTSDAGRALAVGKLLQRDISGLDINMGCPKEFSIKGGMGAALLAD 146
            ......:||.::.. |::|...:||.:.|....|.|.....:|||:|||:..:.:|..|:.|..:
  Fly    71 YRKDALQTCPEDRP-LIIQFCGNDAQQILDAALLAQDHCDAVDINLGCPQAIAKRGHYGSFLQDE 134

  Fly   147 PDKAAHILRTLCSGLDIPVTCKIRILPDVEGTIDLVQKLAATGIAAIGIHARTRDERPQHP---- 207
            .:....|:.||.:.|.:||||||||..|:|.||...:.|.|.|...:.:|.|||:::  .|    
  Fly   135 WELLTEIVSTLHAKLAVPVTCKIRIFEDLEKTIRYAKMLEAAGCQLLTVHGRTREQK--GPLTGV 197

  Fly   208 AHPEVLRAVAQAVDIPIIANGGSKNMHCYDDLRKFQMECGADSVMVARAAQINVSIFR---PEGL 269
            |:...::.|.|.:.||::|||   |:...||:.:...|.|.|.||.|.....|.:||:   |   
  Fly   198 ANWNYIKNVRQHIKIPMLANG---NILALDDVHRCLTETGVDGVMSAEGNLHNPAIFKGVSP--- 256

  Fly   270 LPMDELIEKYLRLCVDYDNAPHNAKYCVQSILRELQETPRGKRFLQCQTLQQICEIWELGDYCRR 334
             |:.::..:||.|.        ....|..|.:       ||..|.....:..|.:..||..|...
  Fly   257 -PVWQMAHEYLELV--------QLHPCPSSFI-------RGHLFKLFHHIMNIRQNSELRQYLAT 305

  Fly   335 KQR--ELKTMGNSGRAEVEP---------PEALAKRQKLEDAAIAITDEYDGIICRHMPFLRSTY 388
            ..:  :.:.:....||:.||         ||.:|...: ||..::      ..:|:  |::|:: 
  Fly   306 ANQLVQFQAVVQQVRAKYEPFHKGEVPYEPEQMAAGSE-EDLPLS------PWLCQ--PYIRAS- 360

  Fly   389 PSDNHLPKTQLYVHAVKTGKSPPAYETQQCDKLFRSICTYDGQRFSSSFWEK--------NKKQA 445
             .::|   .|.....|:..:.|...:.|..||        ||:..|....:|        ||.:|
  Fly   361 -PESH---RQKIAEKVREAEDPNRTKRQYFDK--------DGKEISRKRMKKLRRRQRRPNKTEA 413

  Fly   446 EQGAALVALLHLGQLE--AEVLRDNGS 470
            :     :...|..:||  :|.....||
  Fly   414 Q-----IQHRHERRLEYCSECANPQGS 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1434NP_001285237.1 DusA 14..287 CDD:223120 83/276 (30%)
DUS_like_FMN 25..266 CDD:239200 76/252 (30%)
Rnc <317..461 CDD:223644 31/162 (19%)
DSRM 395..457 CDD:238007 13/69 (19%)
CG3645NP_001259809.1 DUS_like_FMN 29..259 CDD:239200 77/254 (30%)
Dus 31..303 CDD:279540 88/311 (28%)
put_zinc_LRP1 426..>460 CDD:130684 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464255
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.