DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1434 and Dus1l

DIOPT Version :9

Sequence 1:NP_001285237.1 Gene:CG1434 / 32377 FlyBaseID:FBgn0030554 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_742015.2 Gene:Dus1l / 246185 RGDID:708389 Length:475 Species:Rattus norvegicus


Alignment Length:412 Identity:105/412 - (25%)
Similarity:176/412 - (42%) Gaps:88/412 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILAPMVRVGTLPMRLLALEMGADIVYTEELVDIKLIK--SIRRPNPALGTVDFVDPSDGTIVFRT 89
            ::||||....|..|||:...||.:.||..|.....::  :.|:.|....    |.|.|..::.:.
  Rat    20 VVAPMVDQSELAWRLLSRRHGAQLCYTPMLHAQVFVRDANYRKENLYCD----VCPEDRPLIVQF 80

  Fly    90 CAQETSRLVLQMGTSDAGRALAVGKLLQRD-ISGLDINMGCPKEFSIKGGMGAALLADPDKAAHI 153
            ||.:....|             ...||.:| ...:|:|:|||:..:.:|..||.|..:.|....:
  Rat    81 CANDPEVFV-------------QAALLAQDYCDAIDLNLGCPQMIAKRGRYGAFLQEEWDLLQRM 132

  Fly   154 LRTLCSGLDIPVTCKIRILPDVEGTIDLVQKLAATGIAAIGIHARTRDER-PQ-HPAHPEVLRAV 216
            :......|.:|||||||:.|:::.|:...|.|...|...:.:|.||:::: |. ..|..|.::||
  Rat   133 ILLAHERLSVPVTCKIRVFPEIDKTVRYAQMLEKAGCQLLTVHGRTKEQKGPMAGTASWEHIKAV 197

  Fly   217 AQAVDIPIIANGGSKNMHCYDDLRKFQMECGADSVMVARAAQINVSIFRPEGLLP-MDELIEKYL 280
            .:||.||:.|||   |:.|..|:.:...:.|...||.|.....|.::|  ||..| :.||.::||
  Rat   198 RKAVGIPVFANG---NIRCLQDVERCIQDTGVQGVMSAEGNLHNPALF--EGRSPAVWELADEYL 257

  Fly   281 RLCVDYDNAPHNAKYCVQSILRELQETPRGKRFLQCQTLQQICEIW----ELGDYCRRKQRELKT 341
            .:...:.        |..|.:|                 ..:.::|    ::....|.:..::||
  Rat   258 DIVRQHP--------CPLSYVR-----------------AHLFKLWHHTLQVHQQLREELAKVKT 297

  Fly   342 MGNSGRAEVEPPEALAKRQKLEDAAIAITDEYDGI-----------ICRHMPFLRSTYPSDNHLP 395
            :  .|.|.|.  :||..|.: ||.|    .:.:|:           ||:  |::|   |......
  Rat   298 L--EGVAAVS--QALKLRCQ-EDMA----RQQEGVRPADNLPAFHWICQ--PYIR---PGPKEGS 348

  Fly   396 KTQLYVHAVKTGKSPPAYETQQ 417
            |..      .:|:|..|.|.::
  Rat   349 KEN------SSGRSKRALEEEE 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1434NP_001285237.1 DusA 14..287 CDD:223120 78/265 (29%)
DUS_like_FMN 25..266 CDD:239200 71/243 (29%)
Rnc <317..461 CDD:223644 24/116 (21%)
DSRM 395..457 CDD:238007 5/23 (22%)
Dus1lNP_742015.2 DUS_like_FMN 18..250 CDD:239200 74/251 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 343..387 5/28 (18%)
put_zinc_LRP1 396..>431 CDD:130684
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.