DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1434 and T26G10.8

DIOPT Version :9

Sequence 1:NP_001285237.1 Gene:CG1434 / 32377 FlyBaseID:FBgn0030554 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001254987.1 Gene:T26G10.8 / 13190790 WormBaseID:WBGene00206421 Length:83 Species:Caenorhabditis elegans


Alignment Length:73 Identity:22/73 - (30%)
Similarity:34/73 - (46%) Gaps:10/73 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 KYCVQSILRELQE-TPRGKRFLQCQTLQQICEIWELGDYCRRKQRELKTMGNSGRAEVEPPEALA 357
            ||.||.||...|| .||||..:...::.|||.       ....::||..:  ..|:|.:||....
 Worm     3 KYVVQRILGADQEYDPRGKATVAAGSVLQICR-------ASADRKELFVI--ISRSENQPPRRTV 58

  Fly   358 KRQKLEDA 365
            :.::..|:
 Worm    59 RNRRKRDS 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1434NP_001285237.1 DusA 14..287 CDD:223120
DUS_like_FMN 25..266 CDD:239200
Rnc <317..461 CDD:223644 10/49 (20%)
DSRM 395..457 CDD:238007
T26G10.8NP_001254987.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0042
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004414
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.