powered by:
Protein Alignment CG1434 and T26G10.8
DIOPT Version :9
Sequence 1: | NP_001285237.1 |
Gene: | CG1434 / 32377 |
FlyBaseID: | FBgn0030554 |
Length: | 473 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001254987.1 |
Gene: | T26G10.8 / 13190790 |
WormBaseID: | WBGene00206421 |
Length: | 83 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 22/73 - (30%) |
Similarity: | 34/73 - (46%) |
Gaps: | 10/73 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 294 KYCVQSILRELQE-TPRGKRFLQCQTLQQICEIWELGDYCRRKQRELKTMGNSGRAEVEPPEALA 357
||.||.||...|| .||||..:...::.|||. ....::||..: ..|:|.:||....
Worm 3 KYVVQRILGADQEYDPRGKATVAAGSVLQICR-------ASADRKELFVI--ISRSENQPPRRTV 58
Fly 358 KRQKLEDA 365
:.::..|:
Worm 59 RNRRKRDS 66
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0042 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004414 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.