DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and MRPL35

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_010608.1 Gene:MRPL35 / 851921 SGDID:S000002730 Length:367 Species:Saccharomyces cerevisiae


Alignment Length:344 Identity:73/344 - (21%)
Similarity:133/344 - (38%) Gaps:86/344 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PPGVARSLEQRIREENVEDPEVVARINIGFPQLKESRSAQLKKRLEH--------LKSQRSDKQL 94
            ||.::|. ..||:....|..:.:.|::..|.:.:.|:..:|..:.::        :|::.::.::
Yeast    52 PPSISRR-SNRIKYSPPEHIDEIFRMSYDFLEQRSSKFYELANKTKNPLKKDALLIKAEINNPEV 115

  Fly    95 E-QLARSNKL-----IIDLD-KVQRTYVKTTGQHDLRLVADHYG---IFEHLFGSA-------YF 142
            : ....:|||     |||.| .|.|...|   ||     .:.||   :.:.|...|       ..
Yeast   116 QYNFQFNNKLNNVKDIIDYDVPVYRHLGK---QH-----WESYGQMLLMQRLETLAAIPDTLPTL 172

  Fly   143 VPRVPLNISYQLD---------GDSLAPVYNGNVIKPTEAAKAPQIDFDGLVDPITGQAAGQDTY 198
            |||..:||.:...         |:.|    :.||.......|..:.:...:          :...
Yeast   173 VPRAEVNIKFPFSTGVNKWIEPGEFL----SSNVTSMRPIFKIQEYELVNV----------EKQL 223

  Fly   199 WTLVASNPD----AHYTNGTAECLHWFIANI----------PNGKVSEGQVLAEYLPPFPPRGVG 249
            :|::..|||    ::.:..||.|  :.:.||          |. |.....::|:||||.|.:..|
Yeast   224 YTVLIVNPDVPDLSNDSFKTALC--YGLVNINLTYNDNLIDPR-KFHSSNIIADYLPPVPEKNAG 285

  Fly   250 YQRMVFVLYKQQARLDLGSYQLAAADYGNLEKRTFSTLDFYRQHQEQLTPAGLAFYQTNWDESLT 314
            .||.|..:::|....|.....:...|...|.:..|....|.:::  .||..|...:::.||..  
Yeast   286 KQRFVVWVFRQPLIEDKQGPNMLEIDRKELSRDDFDIRQFTKKY--NLTAIGAHIWRSEWDAK-- 346

  Fly   315 QFYHDVLKIKEPVYEYDFP 333
                 |..::|   :|..|
Yeast   347 -----VAAVRE---KYGLP 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 37/183 (20%)
MRPL35NP_010608.1 PEBP_euk 178..341 CDD:176644 37/181 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.