DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and YLR179C

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_013280.1 Gene:YLR179C / 850876 SGDID:S000004169 Length:201 Species:Saccharomyces cerevisiae


Alignment Length:188 Identity:49/188 - (26%)
Similarity:82/188 - (43%) Gaps:31/188 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 LNISYQLDGDSLAPVYNGNVIKPTEAAK-APQIDFDGLVDPITGQAAGQDTYWTLVASNPDA--H 209
            |::|| :|.|.   :..||.: |.||.: ||.|.|    .|........:....|:.::|||  .
Yeast    30 LSVSY-VDSDD---IKLGNPM-PMEATQAAPTIKF----TPFDKSQLSAEDKLALLMTDPDAPSR 85

  Fly   210 YTNGTAECLHWFIANI-----PNGKVS---EGQVLAEYLPPFPPRGVGYQRMVFVLYKQQARLDL 266
            ..:..:|..|:.|.:|     |.|.::   :|.|...|:.|.||:..||.|.||.|.||....|.
Yeast    86 TEHKWSEVCHYIITDIPVEYGPGGDIAISGKGVVRNNYIGPGPPKNSGYHRYVFFLCKQPKGADS 150

  Fly   267 GSY----QLAAADYGNLEKRTFSTLDFYRQHQEQLTPAGLAFYQTNWDESLTQFYHDV 320
            .::    .:.:..||......:   |:.:::..||  .|..:|..  :.:...|.:|:
Yeast   151 STFTKVENIISWGYGTPGAGAY---DYIKENNLQL--VGANYYMV--ENTTVDFNYDM 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 47/173 (27%)
YLR179CNP_013280.1 PEBP_euk 30..190 CDD:176644 47/173 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.