DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and FT

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001320342.1 Gene:FT / 842859 AraportID:AT1G65480 Length:219 Species:Arabidopsis thaliana


Alignment Length:298 Identity:59/298 - (19%)
Similarity:103/298 - (34%) Gaps:114/298 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VAVRDAQAAVLMTATRQGHTIRGKPPGVARSLEQRIREENVEDPEVVARINIGFPQLKESRSAQL 78
            :.:::|:     |.|.:..||..:.|.|....:..|   |:.||.:|:|: :|......:||..|
plant    17 IQIKEAE-----TKTSKTETINTEKPPVCSRSKMSI---NIRDPLIVSRV-VGDVLDPFNRSITL 72

  Fly    79 KKRLEHLKSQRSDKQLEQLARSNKLIIDLDKVQRTYVKTTGQHDLRLVADHYGIFEHLFGSAYFV 143
            |                                    .|.||.:                     
plant    73 K------------------------------------VTYGQRE--------------------- 80

  Fly   144 PRVPLNISYQLDGDSLAPVYNGNVIKPTEAAKAPQIDFDGLVDPITGQAAGQD--TYWTLVASNP 206
                              |.||..::|::....|:::.           .|:|  .::|||..:|
plant    81 ------------------VTNGLDLRPSQVQNKPRVEI-----------GGEDLRNFYTLVMVDP 116

  Fly   207 DAHYTNG--TAECLHWFIANIP--NGKVSEGQVLAEYLPPFPPRGVGYQRMVFVLYKQQARLDLG 267
            |....:.  ..|.|||.:.:||  .|.....:::. |..|.|..|:  .|:||:|::|     ||
plant   117 DVPSPSNPHLREYLHWLVTDIPATTGTTFGNEIVC-YENPSPTAGI--HRVVFILFRQ-----LG 173

  Fly   268 SYQLAAADYGNLEKRTFSTLDFYRQHQEQLTPAGLAFY 305
            ...:.|..:    ::.|:|.:|...:...| |....||
plant   174 RQTVYAPGW----RQNFNTREFAEIYNLGL-PVAAVFY 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 38/166 (23%)
FTNP_001320342.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.