DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and E12A11

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_173250.1 Gene:E12A11 / 838390 AraportID:AT1G18100 Length:173 Species:Arabidopsis thaliana


Alignment Length:170 Identity:45/170 - (26%)
Similarity:68/170 - (40%) Gaps:50/170 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 SAYFVPRVPLNISYQLDGDSLAPVYNGNVIKPTEAAKAPQIDFDGLVDPITGQAAGQDTYWTLVA 203
            |.||.|:               .:.||..|||:.|...|:::..|          ..|..:|||.
plant    28 SVYFGPK---------------HITNGCEIKPSTAVNPPKVNISG----------HSDELYTLVM 67

  Fly   204 SNPDAHYTN--GTAECLHWFIANIPNG-KVSEGQVLAEYLPPFPPRGVGYQRMVFVLYKQQA--- 262
            ::|||...:  ...|.:||.:.:||.| ..|.|:.:..|:.|.||  ||..|.:.||::|.:   
plant    68 TDPDAPSPSEPNMREWVHWIVVDIPGGTNPSRGKEILPYMEPRPP--VGIHRYILVLFRQNSPVG 130

  Fly   263 --------------RLDLGSYQL---AAADYGNLEKRTFS 285
                          |:..|.:.|   .|..|.|.:|...|
plant   131 LMVQQPPSRANFSTRMFAGHFDLGLPVATVYFNAQKEPAS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 41/163 (25%)
E12A11NP_173250.1 PEBP 6..173 CDD:412238 45/170 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.