DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and TFL1

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_196004.1 Gene:TFL1 / 831683 AraportID:AT5G03840 Length:177 Species:Arabidopsis thaliana


Alignment Length:168 Identity:43/168 - (25%)
Similarity:74/168 - (44%) Gaps:29/168 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 YFVPRVPLNISYQLDGDSLAPVYNGNVIKPTEAAKAPQIDFDGLVDPITGQAAGQDTYWTLVASN 205
            :|.|...:|:||     :...|.||:.:.|:..:..|:::..|         ....:::|||..:
plant    24 FFTPTTKMNVSY-----NKKQVSNGHELFPSSVSSKPRVEIHG---------GDLRSFFTLVMID 74

  Fly   206 PDAHYTNG--TAECLHWFIANIP-NGKVSEGQVLAEYLPPFPPRGVGYQRMVFVLYKQQARLDLG 267
            ||....:.  ..|.|||.:.||| ....:.|:.:..|..|.|  .:|..|.||||::|:.|..: 
plant    75 PDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSYELPRP--SIGIHRFVFVLFRQKQRRVI- 136

  Fly   268 SYQLAAADYGNLEKRT-FSTLDFYRQHQEQLTPAGLAF 304
                    :.|:..|. |:|..|..::...|..|.:.|
plant   137 --------FPNIPSRDHFNTRKFAVEYDLGLPVAAVFF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 41/163 (25%)
TFL1NP_196004.1 PEBP 4..177 CDD:412238 43/168 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.