DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and AT5G01300

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_195750.1 Gene:AT5G01300 / 830983 AraportID:AT5G01300 Length:162 Species:Arabidopsis thaliana


Alignment Length:72 Identity:18/72 - (25%)
Similarity:27/72 - (37%) Gaps:22/72 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 APQIDFDGLVD---PITGQAAGQDTYWTLVASNPDAHYTNGTAECLHWFIANIPNGKVSEGQVLA 237
            :|.||.||.:.   .:.||...:|      .|.|           |.|:  |:|.|..:...|:.
plant    10 SPTIDNDGKLPRKYTMAGQGVKKD------ISPP-----------LEWY--NVPEGTKTLALVVE 55

  Fly   238 EYLPPFP 244
            :...|.|
plant    56 DIDAPDP 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 18/72 (25%)
AT5G01300NP_195750.1 PEBP_bact_arch 7..159 CDD:176643 18/72 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.