powered by:
Protein Alignment mRpL38 and AT5G01300
DIOPT Version :9
Sequence 1: | NP_511152.2 |
Gene: | mRpL38 / 32375 |
FlyBaseID: | FBgn0030552 |
Length: | 416 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_195750.1 |
Gene: | AT5G01300 / 830983 |
AraportID: | AT5G01300 |
Length: | 162 |
Species: | Arabidopsis thaliana |
Alignment Length: | 72 |
Identity: | 18/72 - (25%) |
Similarity: | 27/72 - (37%) |
Gaps: | 22/72 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 176 APQIDFDGLVD---PITGQAAGQDTYWTLVASNPDAHYTNGTAECLHWFIANIPNGKVSEGQVLA 237
:|.||.||.:. .:.||...:| .|.| |.|: |:|.|..:...|:.
plant 10 SPTIDNDGKLPRKYTMAGQGVKKD------ISPP-----------LEWY--NVPEGTKTLALVVE 55
Fly 238 EYLPPFP 244
:...|.|
plant 56 DIDAPDP 62
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1881 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1557122at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.