DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and TSF

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_193770.1 Gene:TSF / 827785 AraportID:AT4G20370 Length:175 Species:Arabidopsis thaliana


Alignment Length:154 Identity:40/154 - (25%)
Similarity:66/154 - (42%) Gaps:34/154 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 FVPRVPLNISYQLDGDSLAPVYNGNVIKPTEAAKAPQIDFDGLVDPITGQAAGQD--TYWTLVAS 204
            |...|.|.::|     ....|.||..::|::....|.::.           .|.|  .::|||..
plant    22 FTRLVSLKVTY-----GHREVTNGLDLRPSQVLNKPIVEI-----------GGDDFRNFYTLVMV 70

  Fly   205 NPDAHYTNG--TAECLHWFIANIP--NGKVSEGQVLAEYLPPFPPRGVGYQRMVFVLYKQQARLD 265
            :||....:.  ..|.|||.:.:||  .|.....:|:. |..|.||.|:  .|:|.||::|     
plant    71 DPDVPSPSNPHQREYLHWLVTDIPATTGNAFGNEVVC-YESPRPPSGI--HRIVLVLFRQ----- 127

  Fly   266 LGSYQLAAADYGNLEKRTFSTLDF 289
            ||...:.|..:    ::.|:|.:|
plant   128 LGRQTVYAPGW----RQQFNTREF 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 39/150 (26%)
TSFNP_193770.1 PLN00169 1..175 CDD:177765 40/154 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.