DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and ATC

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_180324.1 Gene:ATC / 817302 AraportID:AT2G27550 Length:175 Species:Arabidopsis thaliana


Alignment Length:167 Identity:43/167 - (25%)
Similarity:73/167 - (43%) Gaps:35/167 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 VPLNISYQLDGDSLAPVYNGNVIKPTEAAKAPQIDFDGLVDPITGQAAGQDTYWTLVASNPDAHY 210
            |.:.::|..|    ..||||:.:.|:.....|:::..|         ....:::|||.::||...
plant    26 VKMTVTYNSD----KQVYNGHELFPSVVTYKPKVEVHG---------GDMRSFFTLVMTDPDVPG 77

  Fly   211 TNG--TAECLHWFIANIP-NGKVSEGQVLAEYLPPFPPRGVGYQRMVFVLYKQQAR---LDLGSY 269
            .:.  ..|.|||.:.:|| ...||.|:.:..|..|.|  .:|..|.|::|:||..|   :.:.||
plant    78 PSDPYLREHLHWIVTDIPGTTDVSFGKEIIGYEMPRP--NIGIHRFVYLLFKQTRRGSVVSVPSY 140

  Fly   270 QLAAADYGNLEKRTFSTLDFYRQHQEQL-TPAGLAFY 305
                       :..|:|.:|  .|:..| .|....|:
plant   141 -----------RDQFNTREF--AHENDLGLPVAAVFF 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 43/167 (26%)
ATCNP_180324.1 PEBP 7..175 CDD:412238 43/167 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.