DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and Pebp4

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_082836.2 Gene:Pebp4 / 73523 MGIID:1920773 Length:242 Species:Mus musculus


Alignment Length:205 Identity:57/205 - (27%)
Similarity:80/205 - (39%) Gaps:55/205 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 GSAYFVPRVP---------LNISYQLDGD---SLAPVYNGNVIKPTEAAKAPQIDF----DG--- 183
            |...|:|.:|         |.:.|...|:   .:.|..|....|.| |.:||.:.|    ||   
Mouse    49 GRGCFLPPLPKEDVSLCRNLEVFYMEMGNISCKIVPKCNLYRQKIT-AWQAPIVKFHTALDGALY 112

  Fly   184 ---LVDPITGQAAGQDTYWTLVASNPDAHYTNGTAECLHWFIANIPNGKVS----EGQVLAEYLP 241
               :|||   .|..:        |||...|..      ||.::||....:.    .|.||::|.|
Mouse   113 LLVMVDP---DAPSR--------SNPVMKYWR------HWLVSNITGADMKSGSIRGNVLSDYSP 160

  Fly   242 PFPPRGVGYQRMVFVLYKQQARLDLGSYQLAAADYG--NLEKRTFSTLDFYRQHQEQLTPAGLAF 304
            |.||...|..|..|.:|.|..| |:.......||.|  ||:|       |.:|:..: .|.....
Mouse   161 PTPPPETGLHRYQFFVYLQGDR-DISLSVEEKADLGGWNLDK-------FLQQYGLR-DPDTSTQ 216

  Fly   305 YQTNWDESLT 314
            :.|.:||.|:
Mouse   217 FMTQFDEELS 226

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 50/188 (27%)