DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and Pebp4

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_008769058.2 Gene:Pebp4 / 691997 RGDID:1593295 Length:235 Species:Rattus norvegicus


Alignment Length:204 Identity:46/204 - (22%)
Similarity:72/204 - (35%) Gaps:55/204 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 GSAYFVPRVP---------LNISYQLDGDSLAPV------YNGNVIKPTEAAKAPQIDFDGLVDP 187
            |...|:|.:|         |.:.|...|:....|      |...::    ..::|.:.|.|.:| 
  Rat    42 GRGCFLPPLPKEDVSLCRNLEVFYMEMGNISCKVVPKCNQYRRKIM----TWQSPIVKFHGALD- 101

  Fly   188 ITGQAAGQDTYWTLVASNPDA--------HYTNGTAECLHWFIANI-----PNGKVSEGQVLAEY 239
                    ...:.||..:|||        .|..      ||.::||     .:|.: .|.::.:|
  Rat   102 --------GAQYLLVMVDPDAPSRSNPRMKYWR------HWVVSNITGTDMKSGSI-RGNIITDY 151

  Fly   240 LPPFPPRGVGYQRMVFVLYKQQARLDLGSYQLAAADYGNLEKRTFSTLDFYRQHQEQLTPAGLAF 304
            .||.||...|..|..|.:|.|      |...::..:..| |.|....||.:.|......|.....
  Rat   152 QPPTPPPTTGLHRYQFFVYLQ------GDRDISIPESEN-ENRGAWKLDKFLQQYGLQDPDTSTQ 209

  Fly   305 YQTNWDESL 313
            :.|.:|..|
  Rat   210 FMTQFDGEL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 40/188 (21%)
Pebp4XP_008769058.2 PEBP_euk 60..212 CDD:176644 39/178 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.