DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and MRPL38

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_115867.2 Gene:MRPL38 / 64978 HGNCID:14033 Length:380 Species:Homo sapiens


Alignment Length:313 Identity:127/313 - (40%)
Similarity:191/313 - (61%) Gaps:28/313 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DPEVVARINIGFPQLKESRSAQLKKRLEHLKSQRSDKQLEQLARSNKLIIDLDKVQRTYVKTTGQ 120
            ||:  .:|:||.|..|.||:.||.:|.:.::..|::.:.|:.||.....:.||.|:..:.:|.|.
Human    83 DPK--EKIDIGLPPPKVSRTQQLLERKQAIQELRANVEEERAARLRTASVPLDAVRAEWERTCGP 145

  Fly   121 HDLRLVADHYGIFEHLFGSAYFVPRVPLNISYQLDGDSLAPVYNGNVIKPTEAAKAPQIDFDGLV 185
            :..:.:|::||::..||..|.|||||||:::|.:..|.|.|||.||.:.|||||:||::.::   
Human   146 YHKQRLAEYYGLYRDLFHGATFVPRVPLHVAYAVGEDDLMPVYCGNEVTPTEAAQAPEVTYE--- 207

  Fly   186 DPITGQAAGQDTYWTLVASNPDAHYTNGTAECLHWFIANIPNGKVSEGQVLAEYLPPFPPRGVGY 250
                   |.:.:.|||:.::.|.|.....||.|||.:.|||..:|:||||...||||||.||.|.
Human   208 -------AEEGSLWTLLLTSLDGHLLEPDAEYLHWLLTNIPGNRVAEGQVTCPYLPPFPARGSGI 265

  Fly   251 QRMVFVLYKQQARLDLGS-------YQLAAADYGNLEKRTFSTLDFYRQHQEQLTPAGLAFYQTN 308
            .|:.|:|:||...:|...       ||||        :|||.|.|||::|||.:|||||:|:|..
Human   266 HRLAFLLFKQDQPIDFSEDARPSPCYQLA--------QRTFRTFDFYKKHQETMTPAGLSFFQCR 322

  Fly   309 WDESLTQFYHDVLKIKEPVYEYDFPKPYLTDQKFFPLKQPFNLYMDKHRDQKQ 361
            ||:|:|..:|.:|.::|||:|:..|.||...||.||.:||.. |:|::||..:
Human   323 WDDSVTYIFHQLLDMREPVFEFVRPPPYHPKQKRFPHRQPLR-YLDRYRDSHE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 72/167 (43%)
MRPL38NP_115867.2 PEBP_euk 171..321 CDD:176644 72/167 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159347
Domainoid 1 1.000 96 1.000 Domainoid score I7396
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11476
Inparanoid 1 1.050 249 1.000 Inparanoid score I3244
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46095
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0007434
OrthoInspector 1 1.000 - - oto88463
orthoMCL 1 0.900 - - OOG6_107564
Panther 1 1.100 - - LDO PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5565
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.