DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and Mrpl38

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_077139.2 Gene:Mrpl38 / 60441 MGIID:1926269 Length:380 Species:Mus musculus


Alignment Length:319 Identity:124/319 - (38%)
Similarity:193/319 - (60%) Gaps:26/319 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 REENVEDPEVVARINIGFPQLKESRSAQLKKRLEHLKSQRSDKQLEQLARSNKLIIDLDKVQRTY 114
            ||..|::.:...:|:||.|..:.||:.:|.:|...|:..|::.:.|:.||.....|.|:.|:..:
Mouse    75 REHFVKETDPKDKIDIGLPPPRVSRTQKLLERKHFLRELRANVEEERAARLRTASIPLEAVRAEW 139

  Fly   115 VKTTGQHDLRLVADHYGIFEHLFGSAYFVPRVPLNISYQLDGDSLAPVYNGNVIKPTEAAKAPQI 179
            .:|.|.:..:.:|::||::..||..|.|||.|||:::|.:..:.|.|||:||.:.||||::||::
Mouse   140 ERTCGPYHKQRLAEYYGLYRDLFHGATFVPWVPLHVAYAVGEEDLIPVYHGNEVTPTEASRAPEV 204

  Fly   180 DFDGLVDPITGQAAGQDTYWTLVASNPDAHYTNGTAECLHWFIANIPNGKVSEGQVLAEYLPPFP 244
            .::          |.:|:.|||:..|.|.|.....||.:||.:.|||:.:|:|||....||||||
Mouse   205 TYE----------ADKDSLWTLLFINLDGHLLEPDAEYVHWLLTNIPSNRVAEGQETCPYLPPFP 259

  Fly   245 PRGVGYQRMVFVLYKQQARLDLGS-------YQLAAADYGNLEKRTFSTLDFYRQHQEQLTPAGL 302
            .||.|:.|..|:|:||...::...       ||||        :|||.|.|||::|||.:|||||
Mouse   260 ARGSGFHRFAFLLFKQDKPINFSEDTRPSPCYQLA--------QRTFRTFDFYKRHQEAMTPAGL 316

  Fly   303 AFYQTNWDESLTQFYHDVLKIKEPVYEYDFPKPYLTDQKFFPLKQPFNLYMDKHRDQKQ 361
            ||:|..||:|:|..:|.:|.::|||:|:..|.||...||.||.:||.. |:|::||..:
Mouse   317 AFFQCRWDDSVTHTFHQLLDMREPVFEFVRPPPYHPKQKRFPHEQPLR-YLDRYRDSHE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 70/167 (42%)
Mrpl38NP_077139.2 PEBP_euk 171..321 CDD:176644 70/167 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849717
Domainoid 1 1.000 96 1.000 Domainoid score I7346
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11476
Inparanoid 1 1.050 245 1.000 Inparanoid score I3272
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46095
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0007434
OrthoInspector 1 1.000 - - oto92034
orthoMCL 1 0.900 - - OOG6_107564
Panther 1 1.100 - - LDO PTHR11362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4247
SonicParanoid 1 1.000 - - X5565
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.