DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and mrpl38

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_012814540.2 Gene:mrpl38 / 549900 XenbaseID:XB-GENE-5959674 Length:406 Species:Xenopus tropicalis


Alignment Length:302 Identity:118/302 - (39%)
Similarity:186/302 - (61%) Gaps:16/302 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RINIGFPQL--KESRSAQLKKRLEHLKSQRSDKQLEQLARSNKLIIDLDKVQRTYVKTTGQHDLR 124
            :.:||||..  :.:::.|.:|::  |:....:.:||:.||...|.|.||:||..:.:|||:..::
 Frog   113 KADIGFPHFTPRNAKTTQARKQI--LRENHRNPELERAARLRTLRIPLDEVQAEWERTTGRSHVQ 175

  Fly   125 LVADHYGIFEHLFGSAYFVPRVPLNISYQLDGDSLAPVYNGNVIKPTEAAKAPQIDFDGLVDPIT 189
            .||:|||:|:.|||.|.|||.|.|.:.|....:.|.|||:||::.|.||:..|::.|:       
 Frog   176 RVAEHYGVFKDLFGDATFVPSVTLRVQYNKGDEFLMPVYHGNLVTPAEASGPPEVTFE------- 233

  Fly   190 GQAAGQDTYWTLVASNPDAHYTNGTAECLHWFIANIPNGKVSEGQVLAEYLPPFPPRGVGYQRMV 254
               |.:.:.|||:.:|||.|.....:|.:.|.:.|||..:|..|:.:..|.||||.:|.||.|.:
 Frog   234 ---AEEGSLWTLLLTNPDGHLKETDSEYVLWLVGNIPGNQVHSGEQICHYFPPFPAKGTGYHRHI 295

  Fly   255 FVLYKQQARLDLGSYQLAAADYGNLEKRTFSTLDFYRQHQEQLTPAGLAFYQTNWDESLTQFYHD 319
            |:|:||..|::... :|......:|:.|||.||||||:::|.||||||||:|..||:|:||.||.
 Frog   296 FLLFKQDRRIEFKD-ELRPNPCHSLKLRTFKTLDFYRKYEESLTPAGLAFFQCAWDDSVTQVYHQ 359

  Fly   320 VLKIKEPVYEYDFPKPYLTDQKFFPLKQPFNLYMDKHRDQKQ 361
            :|.::|||:||:....|...|..:|..:|.. |:|::||.::
 Frog   360 LLNMREPVFEYERSPKYHPKQVKYPHGKPLR-YLDRYRDSEE 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 63/160 (39%)
mrpl38XP_012814540.2 PEBP_euk 197..347 CDD:176644 63/160 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7526
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11476
Inparanoid 1 1.050 240 1.000 Inparanoid score I3265
OMA 1 1.010 - - QHG46095
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0007434
OrthoInspector 1 1.000 - - oto102341
Panther 1 1.100 - - LDO PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5565
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.