DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and Pebp1

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651051.1 Gene:Pebp1 / 42644 FlyBaseID:FBgn0038973 Length:176 Species:Drosophila melanogaster


Alignment Length:159 Identity:45/159 - (28%)
Similarity:69/159 - (43%) Gaps:36/159 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 GNVIKPTEAAKAPQIDFDGLVDPITGQAAGQDTYWTLVASNPDAHYTNGT--AECLHWFIANIPN 227
            |..:.||:....|.:.||          |..::.:|::..:|||......  .|.|||.:.|||.
  Fly    32 GKELTPTQVKDQPTVVFD----------AEPNSLYTILLVDPDAPSREDPKFRELLHWLVINIPG 86

  Fly   228 GKVSEGQVLAEYLPPFPPRGVGYQRMVFVLYKQQARLD----------LGSYQLAAADYGNLEKR 282
            .||||||.:|||:...|..|.|..|.||:::||..::.          .|...:.|.||  ::|.
  Fly    87 NKVSEGQTIAEYIGAGPREGTGLHRYVFLVFKQNDKITTEKFVSKTSRTGRINVKARDY--IQKY 149

  Fly   283 TFSTLDFYRQHQEQLTPAGLAFYQTNWDE 311
            :|.            .|....|:|..:|:
  Fly   150 SFG------------GPVAGNFFQAQYDD 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 43/153 (28%)
Pebp1NP_651051.1 PEBP_euk 20..162 CDD:176644 43/153 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452386
Domainoid 1 1.000 44 1.000 Domainoid score I727
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.