DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and CG7054

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_651050.1 Gene:CG7054 / 42643 FlyBaseID:FBgn0038972 Length:179 Species:Drosophila melanogaster


Alignment Length:173 Identity:51/173 - (29%)
Similarity:76/173 - (43%) Gaps:20/173 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 VPRVPLNISYQLDGDSLAPVYNGNVIKPTEAAKAPQIDFDGLVDPITGQAAGQDTYWTLVASNPD 207
            ||...:.:.|   ||.| .|..||.:.||:....|.:.:.||        .|:....||:..:||
  Fly    12 VPAGTIKVIY---GDDL-EVKQGNELTPTQVKDQPIVSWSGL--------EGKSNLLTLLMVDPD 64

  Fly   208 AHYTNGT--AECLHWFIANIP--NGKVSEGQVLAEYLPPFPPRGVGYQRMVFVLYKQQARLDLGS 268
            |......  .|.|||.:.|||  |...|.|..||:|:...||:..|..|.:|:||:|:.:::...
  Fly    65 APTRQDPKYREILHWSVVNIPGSNENPSGGHSLADYVGSGPPKDTGLHRYIFLLYRQENKIEETP 129

  Fly   269 YQLAAADYGNLEKRTFSTLDFYRQHQEQLTPAGLAFYQTNWDE 311
            ........|.|   .|:..||..:|... .|....:||..:|:
  Fly   130 TISNTTRTGRL---NFNARDFAAKHGLG-EPIAANYYQAQYDD 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 47/164 (29%)
CG7054NP_651050.1 PEBP_euk 15..164 CDD:176644 47/164 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452387
Domainoid 1 1.000 44 1.000 Domainoid score I727
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.