DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and CG17919

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster


Alignment Length:208 Identity:59/208 - (28%)
Similarity:90/208 - (43%) Gaps:38/208 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LVADHYGIFEHLFGSAYFVPRVPLNISYQLDGDSLAPVYNGNVI-------KPTEAAKAPQIDFD 182
            |:|...|..|.:|.|...||.|......||    |...|:.|::       .||:....|.:::|
  Fly    12 LLAVQAGSVEEVFRSHQVVPDVIPEPPNQL----LKVTYSNNLVAKDGVELTPTQVKDQPVVEWD 72

  Fly   183 GLVDPITGQAAGQDTYWTLVASNPDA--HYTNGTAECLHWFIANIPNGKVSEGQVLAEYLPPFPP 245
                      |....::||:.::|||  .......|..||.:|||....::.|:.:|||:...||
  Fly    73 ----------AQPGEFYTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLASGEPIAEYIGSGPP 127

  Fly   246 RGVGYQRMVFVLYKQQARLDLGSYQLAAADYGNLEKRT------FSTLDFYRQHQEQLTPAGLAF 304
            :|.|..|.||:||||..:|:.        |...:.||:      ||...|...| |...|....|
  Fly   128 QGTGLHRYVFLLYKQSGKLEF--------DEERVSKRSRKDRPKFSAAKFAINH-ELGNPIAGTF 183

  Fly   305 YQTNWDESLTQFY 317
            ||..:|:.:.:.:
  Fly   184 YQAQYDDYVPKLH 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 49/175 (28%)
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 47/167 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452383
Domainoid 1 1.000 44 1.000 Domainoid score I727
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.