DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and CG17917

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_649642.1 Gene:CG17917 / 40778 FlyBaseID:FBgn0037431 Length:211 Species:Drosophila melanogaster


Alignment Length:237 Identity:58/237 - (24%)
Similarity:94/237 - (39%) Gaps:67/237 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LKSQR----SDKQLEQLARSNKLIIDLDKVQRTYVKTTGQHDLRLVADHYGIFEHLFGSAYFVPR 145
            |||.|    ||.::.::.||..:|.|:                    .|.|            |:
  Fly     9 LKSTRGVHQSDTEVSKIMRSLDVIPDV--------------------IHIG------------PQ 41

  Fly   146 VPLNISYQLDGDSLAPVYNGNVIKPTEAAKAPQIDFDGLVDPITGQAAGQDTYWTLVASNPDA-- 208
            ..||::|.   ..|| .:.|.|::|.:....|.:.:          .:..:.|:.|:..:||.  
  Fly    42 EFLNVTYH---GHLA-AHCGKVLEPMQVRDEPSVKW----------PSAPENYYALLMVDPDVPN 92

  Fly   209 HYTNGTAECLHWFIANIPNGKVSEGQVLAEYLPPFPPRGVGYQRMVFVLYKQQARLDLGSYQLAA 273
            ..|....|.|||.:.|||...::.|.|...|:...|.:|.|..|.||:||||:   |...:    
  Fly    93 AITPTHREFLHWMVLNIPGNLLALGDVRVGYMGATPLKGTGTHRFVFLLYKQR---DYTKF---- 150

  Fly   274 ADYGNLEKRT------FSTLDFYRQHQEQLTPAGLAFYQTNW 309
             |:..|.|.:      |.|..|.::::.....|| .|:.:.|
  Fly   151 -DFPKLPKHSVKGRSGFETKRFAKKYRFGHPVAG-NFFTSQW 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 44/168 (26%)
CG17917NP_649642.1 PEBP_euk 44..188 CDD:176644 44/166 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452388
Domainoid 1 1.000 44 1.000 Domainoid score I727
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.