DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and pebp1

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_998488.1 Gene:pebp1 / 406627 ZFINID:ZDB-GENE-040426-2621 Length:187 Species:Danio rerio


Alignment Length:181 Identity:49/181 - (27%)
Similarity:78/181 - (43%) Gaps:21/181 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PRVPLNISY-QLDGDSLAPVYNGNVIKPTEAAKAP-QIDFDGLVDPITGQAAGQDTYWTLVASNP 206
            |..||.:.| .::.|||     |.|..||:....| .|:::| .||        ...:||..::|
Zfish    21 PAKPLTVKYDSVEIDSL-----GKVCTPTQVQNRPTSIEWEG-CDP--------SKLYTLAMTDP 71

  Fly   207 DAHYTNGT--AECLHWFIANIPNGKVSEGQVLAEYLPPFPPRGVGYQRMVFVLYKQQARLDLGSY 269
            ||......  .|..|:.:.|:....||.|.|:::|:...||:|.|..|.|:::|:|...:.....
Zfish    72 DAPSRKDPKFREWHHFLVVNVKGNDVSSGCVMSDYVGAGPPKGTGLHRYVWLVYEQSGNISCTER 136

  Fly   270 QLAAADYGNLEKRTFSTLDFYRQHQEQLTPAGLAFYQTNWDESLTQFYHDV 320
            .|......|..|  |....|.:::......||..| |..||..:.:.|..:
Zfish   137 VLTNRSGDNRGK--FKIQSFRKKYSLGAPLAGSCF-QAEWDNYVPKLYEQL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 44/164 (27%)
pebp1NP_998488.1 PEBP_euk 23..171 CDD:176644 44/164 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.