DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and SPBC2F12.10

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001342831.1 Gene:SPBC2F12.10 / 2540365 PomBaseID:SPBC2F12.10 Length:308 Species:Schizosaccharomyces pombe


Alignment Length:314 Identity:66/314 - (21%)
Similarity:119/314 - (37%) Gaps:82/314 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VARSLEQRIREE------NVEDPEVVARINIGFPQLKESRSAQLKKRLEH--------LKSQRSD 91
            |.:.|:.::.|.      .:|..:|:::||     |.|.||...||.:::        ||.|..|
pombe    43 VHKKLQAKLLENPSETSPEIERLQVLSQIN-----LPEVRSKFHKKEIDYTNPVFLYMLKQQWED 102

  Fly    92 KQLEQLARSNKLIIDLDKVQRTYVKTTGQHDLRLVADHYGIFEHLFGSAYFVPRVPLNISYQLD- 155
            .|        ||::    :||.       ..::::.|.        |...|.|.|.:.:.:..: 
pombe   103 YQ--------KLLL----LQRL-------EQMKVIKDS--------GIGSFSPSVDVQLGFNPEN 140

  Fly   156 GDSLAPVYNGNVIKPTEAAKAPQIDFDGLVDPITGQAAGQDTYWTLVASNPDA--HYTNGTAECL 218
            .||:.|   |.::..|...|.|.:.    |.|..    .:..:::::..:.|.  :.||......
pombe   141 NDSITP---GTILPSTVTVKTPWLS----VLPFN----CKKNHYSVITLDLDVPNYETNRFETHC 194

  Fly   219 HWFIANIP-----NGKVSEGQVLAEYLPPFPPRGVGYQR-MVFVLYKQQARLDLGSYQLAAADYG 277
            :|.:.|||     ...:...:...:|.||...||....| :..||.::.:.:.:.|..|.     
pombe   195 NWLLTNIPIEASKRVPIDTSKAFFQYRPPIVHRGEDKHRILTLVLRQKSSSISIPSNALV----- 254

  Fly   278 NLEKRTFSTLDFYRQHQEQLTPAGLAFYQTNWDESLTQFYHDVLKIKEP-VYEY 330
               :..|...:|...:  .|.|.|...:::.||....     .|..|.| |:||
pombe   255 ---RERFDLSEFCSIY--DLEPVGAHLWRSGWDSDAV-----ALLSKHPSVHEY 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 32/169 (19%)
SPBC2F12.10NP_001342831.1 PEBP_euk 130..279 CDD:176644 32/169 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.