DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and CG30060

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_725293.1 Gene:CG30060 / 246426 FlyBaseID:FBgn0265272 Length:202 Species:Drosophila melanogaster


Alignment Length:189 Identity:50/189 - (26%)
Similarity:76/189 - (40%) Gaps:25/189 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 RLVAD--HYGIFEHLFGSAYFVPRVPLNISYQLDGDSLAPVYNGNVIKPTEAAKAPQIDFDGLVD 186
            :||.:  .:.:...||...   |...:::.|..|.|    :..|.::...|..|.|.|.|.  .|
  Fly    13 KLVTELKRHHVIPRLFACK---PTKVISVLYPCDID----IKPGIMVVINETLKQPIIRFK--AD 68

  Fly   187 PITGQAAGQDTYWTLVASNPDAHYTNGTAECLHWFIANIPNGKVSEGQVLAEYLPPFPPRGVGYQ 251
            |        :.|.||:..:.|....|.| |.|.|.:.|||...|:.||.|..|.......|....
  Fly    69 P--------EHYHTLMMVDLDVPPDNNT-EWLIWMVGNIPGCDVAMGQTLVAYDNRRTIHGSNIH 124

  Fly   252 RMVFVLYKQQARLDLG-SYQLAAADYGNLEKRTFSTLDFYRQHQEQLTPAGLAFYQTNW 309
            |:||:.:||...||.. ::.....:.|   :.||:..:|.|::... .|....||...|
  Fly   125 RIVFLAFKQYLELDFDETFVPEGEEKG---RGTFNCHNFARKYALG-NPMAANFYLVEW 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 44/161 (27%)
CG30060NP_725293.1 PEBP_euk 34..177 CDD:176644 44/161 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452389
Domainoid 1 1.000 44 1.000 Domainoid score I727
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.