DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and Pebp1

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_061346.2 Gene:Pebp1 / 23980 MGIID:1344408 Length:187 Species:Mus musculus


Alignment Length:181 Identity:50/181 - (27%)
Similarity:78/181 - (43%) Gaps:21/181 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PRVPLNISYQ-LDGDSLAPVYNGNVIKPTEAAKAP-QIDFDGLVDPITGQAAGQDTYWTLVASNP 206
            |:..|.:.|. :..|.|     |.|:.||:....| .|.:||| ||        ...:|||.::|
Mouse    21 PQHALRVDYAGVTVDEL-----GKVLTPTQVMNRPSSISWDGL-DP--------GKLYTLVLTDP 71

  Fly   207 DAHYTNGT--AECLHWFIANIPNGKVSEGQVLAEYLPPFPPRGVGYQRMVFVLYKQQARLDLGSY 269
            ||......  .|..|:.:.|:....:|.|.||::|:...||.|.|..|.|:::|:|:..|.....
Mouse    72 DAPSRKDPKFREWHHFLVVNMKGNDISSGTVLSDYVGSGPPSGTGLHRYVWLVYEQEQPLSCDEP 136

  Fly   270 QLAAADYGNLEKRTFSTLDFYRQHQEQLTPAGLAFYQTNWDESLTQFYHDV 320
            .|:.....|..|....|   :|:......|.....||..||:.:.:.|..:
Mouse   137 ILSNKSGDNRGKFKVET---FRKKYNLGAPVAGTCYQAEWDDYVPKLYEQL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 45/164 (27%)
Pebp1NP_061346.2 PEBP_euk 25..171 CDD:176644 45/162 (28%)
Interaction with RAF1. /evidence=ECO:0000250 93..134 14/40 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.