DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and F40A3.3

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001300105.1 Gene:F40A3.3 / 179168 WormBaseID:WBGene00018218 Length:226 Species:Caenorhabditis elegans


Alignment Length:190 Identity:49/190 - (25%)
Similarity:76/190 - (40%) Gaps:59/190 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 GNVIKPTEAAKAPQIDFDGLVDPITGQAAGQDTYWTLVASNPDAHYTNGTA--ECLHWFIANIPN 227
            |||:.||:....|::.:|          |.....:||:.::|||.......  |..||.:.|||.
 Worm    79 GNVLTPTQVKDTPEVKWD----------AEPGALYTLIKTDPDAPSRKEPTYREWHHWLVVNIPG 133

  Fly   228 GKVSEGQVLAEYLPPFPPRGVGYQRMVFVLYKQQARLDLGSYQLAAADYGNL-----EKR-TFST 286
            ..:::|..|:||:...||...|..|.|:::|||..|::       .|::|.|     :|| .:..
 Worm   134 NDIAKGDTLSEYIGAGPPPKTGLHRYVYLIYKQSGRIE-------DAEHGRLTNTSGDKRGGWKA 191

  Fly   287 LDFYRQHQEQLTPAGLAFYQTNWDESLTQFYHDVLKIKEPVY------EYDFPKPYLTDQ 340
            .||..:|                            |:..||:      |||...|.|..|
 Worm   192 ADFVAKH----------------------------KLGAPVFGNLFQAEYDDYVPILNKQ 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 40/149 (27%)
F40A3.3NP_001300105.1 PEBP_euk 64..211 CDD:176644 43/176 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.