DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and PEBP4

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001350162.1 Gene:PEBP4 / 157310 HGNCID:28319 Length:227 Species:Homo sapiens


Alignment Length:161 Identity:45/161 - (27%)
Similarity:65/161 - (40%) Gaps:34/161 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 TGQHDLRLVADHYGIFEH--LF--GSAYFVPRVPLNISYQLDGDSLAPVYNGNVIKPTEAAKAPQ 178
            ||..|......|..:.:.  ||  |...|.|.:. ||     |..:.|..| |..:...:...|.
Human    21 TGDEDENSPCAHEALLDEDTLFCQGLEVFYPELG-NI-----GCKVVPDCN-NYRQKITSWMEPI 78

  Fly   179 IDFDGLVDPITGQAAGQDTYWTLVASNPDAHYTNGTAE-----CLHWFI-----ANIPNGKVSEG 233
            :.|.|.||..|         :.||..:|||   ...||     ..||.:     |::..||: :|
Human    79 VKFPGAVDGAT---------YILVMVDPDA---PSRAEPRQRFWRHWLVTDIKGADLKKGKI-QG 130

  Fly   234 QVLAEYLPPFPPRGVGYQRMVFVLYKQQARL 264
            |.|:.|..|.||...|:.|..|.:|.|:.::
Human   131 QELSAYQAPSPPAHSGFHRYQFFVYLQEGKV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 36/129 (28%)
PEBP4NP_001350162.1 PEBP_euk 46..197 CDD:176644 38/136 (28%)
Important for secretion. /evidence=ECO:0000269|PubMed:27033522 188..227
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..227
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.