DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL38 and pebp4

DIOPT Version :9

Sequence 1:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_002932751.1 Gene:pebp4 / 100488878 XenbaseID:XB-GENE-941751 Length:202 Species:Xenopus tropicalis


Alignment Length:147 Identity:38/147 - (25%)
Similarity:51/147 - (34%) Gaps:53/147 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 WTLVASNPDA--------HYTNGTAECLHWFIANIP-----NGKVSEGQVLAEYLPPFPPRGVGY 250
            :.|:..:|||        .|..      ||.:.:||     :|:...|..::.|..|.||.|.||
 Frog    89 YVLIMVDPDAPSRWDPKYRYWR------HWVLTDIPGWQLLSGRDLTGNDISAYRRPSPPPGTGY 147

  Fly   251 QRMVFVLYKQQARLDLGSYQLAAADYGNLEKRTFSTLDFYRQHQEQLTPAGLAFYQTNWDESLTQ 315
            .|..|.||:|...:.|         |...|:...||.|.            .||.|.|       
 Frog   148 HRYQFYLYEQPLWVIL---------YFLPEEIRRSTWDL------------KAFVQRN------- 184

  Fly   316 FYHDVLKIKEPVYEYDF 332
                  |:.|||....|
 Frog   185 ------KLGEPVATTQF 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 31/120 (26%)
pebp4XP_002932751.1 PEBP_euk 42..197 CDD:176644 38/147 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.