DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and SCARF2

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_699165.3 Gene:SCARF2 / 91179 HGNCID:19869 Length:871 Species:Homo sapiens


Alignment Length:323 Identity:76/323 - (23%)
Similarity:96/323 - (29%) Gaps:111/323 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 CAQFERGRCVDMA--CICTARGSGERVPCTPLEERLKLTNIIGGACPCPMPNAICHTRWQQCHCS 97
            |:....|:|.|:.  |.|.||..|.|  |.             .||.|  .:..||.|...|.|.
Human   126 CSCHPHGQCEDVTGQCTCHARRWGAR--CE-------------HACQC--QHGTCHPRSGACRCE 173

  Fly    98 EGHVSSDDRRRCLPAVV----PVGGSCEFQQQCQRADRFSSCIGNQCLC-LNQFEFHEGRCLSVL 157
            .|...:.....|..:..    |..|:|    .|.......|| .|||.| .:..|...|||    
Human   174 PGWWGAQCASACYCSATSRCDPQTGAC----LCHAGWWGRSC-NNQCACNSSPCEQQSGRC---- 229

  Fly   158 QSSCLE-------DKDCGSCGASICLTKTKRCGCSKNFVHNHNMTKCIKGSAYG-------DTCE 208
              .|.|       |:.| .|....|......|.|...:...:....|..| .||       ..|:
Human   230 --QCRERTFGARCDRYC-QCFRGRCHPVDGTCACEPGYRGKYCREPCPAG-FYGLGCRRRCGQCK 290

  Fly   209 HSSPCKLNLGADGRCLDHLC-----------VCRSTHYPKRVANEVAKDENDDLDAVNNLERITC 262
            ...||.:   |:||||  .|           .|.:..|.:..::.                   |
Human   291 GQQPCTV---AEGRCL--TCEPGWNGTKCDQPCATGFYGEGCSHR-------------------C 331

  Fly   263 APIVPFGALCRNDSECRMQPMDQENATASIGHPMVCNWG------ECSCSKTHRLEDNKCVFV 319
            .|       ||:...|       .:.|   |....||.|      |..||.....||  |.||
Human   332 PP-------CRDGHAC-------NHVT---GKCTRCNAGWIGDRCETKCSNGTYGED--CAFV 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 15/61 (25%)
SCARF2NP_699165.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PHA03247 <534..871 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 570..871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.