DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and MEGF10

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_016865476.1 Gene:MEGF10 / 84466 HGNCID:29634 Length:1195 Species:Homo sapiens


Alignment Length:407 Identity:91/407 - (22%)
Similarity:120/407 - (29%) Gaps:157/407 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AGFLATGRAEDLLEL-----SCSSDAQCAQFERGRCVDMA---CICTARGSGERVP--CTP---- 63
            |||.. .|.||..|.     .|....||   :.|...|..   |.|....:|....  |.|    
Human   226 AGFRG-WRCEDRCEQGTYGNDCHQRCQC---QNGATCDHVTGECRCPPGYTGAFCEDLCPPGKHG 286

  Fly    64 --LEERLKLTNIIGGAC--------------------PCP--------------MPNAICHTRWQ 92
              .|:|....|  ||.|                    |||              .....|.....
Human   287 PQCEQRCPCQN--GGVCHHVTGECSCPSGWMGTVCGQPCPEGRFGKNCSQECQCHNGGTCDAATG 349

  Fly    93 QCHCSEGHVSSDDRRRCLPAVVPVGGSCEFQQQCQRADRFSSCIGNQCLCLNQFEFHEGRCLSVL 157
            |||||.|:.....:..|     |||             .:.......|.|:|     .|:|..|.
Human   350 QCHCSPGYTGERCQDEC-----PVG-------------TYGVLCAETCQCVN-----GGKCYHVS 391

  Fly   158 QSSCLEDKDCGS-CGASIC------LTKTKRCGCSKNFVHN-HNMT-KCI-----KGSAYGDTCE 208
            .:...|....|. |.|.:|      :...|||.|.....|: |.|: :|.     .|....:|| 
Human   392 GACLCEAGFAGERCEARLCPEGLYGIKCDKRCPCHLENTHSCHPMSGECACKPGWSGLYCNETC- 455

  Fly   209 HSSPCKLNLGADGRCLDHLCVCRSTHYPKRVANEVAKDENDDLDAVNNLERITCAP--------- 264
              ||     |..|.....:|.|::               ..|.|:|..  :.||||         
Human   456 --SP-----GFYGEACQQICSCQN---------------GADCDSVTG--KCTCAPGFKGIDCST 496

  Fly   265 IVPFGAL---------CRNDSECRMQPMDQENATASIG-HPMVCN-------WG-----ECSCSK 307
            ..|.|..         |:||:.|  .|:| .:.|...| |.:.|:       ||     .|.|  
Human   497 PCPLGTYGINCSSRCGCKNDAVC--SPVD-GSCTCKAGWHGVDCSIRCPSGTWGFGCNLTCQC-- 556

  Fly   308 THRLEDNKCVFVENSAT 324
               |....|..::.:.|
Human   557 ---LNGGACNTLDGTCT 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 11/56 (20%)
MEGF10XP_016865476.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.