DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and dkk1a

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001268729.2 Gene:dkk1a / 799377 ZFINID:ZDB-GENE-090313-406 Length:247 Species:Danio rerio


Alignment Length:233 Identity:48/233 - (20%)
Similarity:79/233 - (33%) Gaps:83/233 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ARGSGERVPCTPLEERLKLTNIIGGACPCPMPNAICHTRWQQCHCSEGHVSSDDRRRCLPAVVPV 116
            |....:.|..:|     ::|..:....| |.|:....:     .||.|...:..|..||      
Zfish    41 ASSPSDAVSASP-----RVTGTVDSDAP-PSPHCSADS-----ECSIGEFCNGSRGVCL------ 88

  Fly   117 GGSC-EFQQQCQRADRFSSCIGNQCLCLNQFEFHEGRCLSVLQSSCLEDKDCGSCG-----ASIC 175
              || :.:::|.|..  ..|.||:|:        .|.| .:..::.:...|....|     :.:.
Zfish    89 --SCRKRRKRCARDG--MCCAGNRCI--------NGVC-QLADAAAVGSADASPPGGNTDVSGVA 140

  Fly   176 LTKTKRCGCSKNFVHNHNMT------KCIKGSAYGDTCEHSSPCKLNLGADGRCLDHLCVCRSTH 234
            :|:      .:||.|....|      :..||.. |:||..||.          ||:.||..|  |
Zfish   141 VTR------GQNFTHPRRTTVLSKPQQTQKGGE-GETCLRSSD----------CLEGLCCAR--H 186

  Fly   235 YPKRVANEVAKDENDDLDAVNNLERITCAPIVPFGALC 272
            :..|:                      |.|::..|.:|
Zfish   187 FWSRI----------------------CKPVLTEGQVC 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 15/57 (26%)
dkk1aNP_001268729.2 Dickkopf_N 68..115 CDD:282549 16/70 (23%)
COLIPASE 167..236 CDD:305210 16/71 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.