DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and megf10

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001072726.1 Gene:megf10 / 780183 XenbaseID:XB-GENE-491974 Length:1114 Species:Xenopus tropicalis


Alignment Length:336 Identity:77/336 - (22%)
Similarity:105/336 - (31%) Gaps:101/336 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CSSDAQCAQFERGRCVDMACICTARGSGERVPCTPLEERLKLTNIIGGACPCPMPNAICHTRWQQ 93
            |||..||........:..||.|::...|.|  |   |||.. ....|..|.            |:
 Frog   147 CSSRCQCKNGALCNPITGACHCSSGYKGWR--C---EERCD-QGTYGNDCQ------------QK 193

  Fly    94 CHCSEG----HVSSDDRRRCLPAVVPVGGSCEFQQQCQRADRFSSCIGNQCLCLNQFEFHE--GR 152
            |.|..|    ||:.:  .||.|..  .|..||  ..|......|.| ..:|.|.|....|.  |.
 Frog   194 CQCQNGASCDHVTGE--CRCPPGY--TGAFCE--DLCPPGKHGSQC-EERCPCQNGGVCHHVTGE 251

  Fly   153 CL-------SVLQSSCLE-------DKDCGSCGASICLTKTKRCGCSKNFVHNHNMTKCIKGSAY 203
            |.       :|....|.|       .::|.......|.:.|.:|.||..:.......:|..| .|
 Frog   252 CSCPAGWMGTVCGQPCPEGRYGRNCSQECQCHNGGTCDSATGQCYCSPGYNGERCQEECPVG-LY 315

  Fly   204 GDTCEHSSPCKLNLGADGRC--LDHLCVCRSTHYPKRVANEVAKDENDDLDAVNNLERITCAPIV 266
            |..|..:..| ||   .|:|  :...|:|...:..:|....:..:..                  
 Frog   316 GVKCAQTCQC-LN---GGKCYHISGACLCEPGYTGERCETPLCSEGT------------------ 358

  Fly   267 PFGALCRNDSECRMQ------PMDQE------------NATASIGHPMVCNWGE-----CSCSKT 308
             :|..|.....|.:|      ||..|            |.|.|:|.     :||     |||...
 Frog   359 -YGMKCDKKCPCHLQYTQSCHPMSGECACKPGRSGLYCNETCSLGF-----YGEFCQQICSCQNG 417

  Fly   309 HRLED--NKCV 317
            ...:.  .||:
 Frog   418 ADCDSVTGKCI 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 18/62 (29%)
megf10NP_001072726.1 EMI 31..98 CDD:369419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.