DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and Megf11

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_038938374.1 Gene:Megf11 / 691517 RGDID:1582797 Length:1139 Species:Rattus norvegicus


Alignment Length:356 Identity:82/356 - (23%)
Similarity:110/356 - (30%) Gaps:140/356 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SCSSDAQCAQFERGRC--VDMACICTARGSGERVPCTPLEERLKLTNIIGGAC--PCPMPNAIC- 87
            :||....|.  ..|.|  ||.:|.|.....|      ||.:|:......|..|  |||    :| 
  Rat   574 NCSVSCSCE--NGGSCSPVDGSCECAPGFRG------PLCQRICPPGFYGHGCAQPCP----LCV 626

  Fly    88 HTRWQQCH--------------------CSEGHVSSDDRRRCLPA----VVPVGGSCEFQQQCQR 128
            |:| ..||                    |:.||...|..:.|..|    ..|:.|||    ||  
  Rat   627 HSR-GPCHHVSGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTCSPIDGSC----QC-- 684

  Fly   129 ADRFSSCIGNQC--LCLNQFEFHEGRCLSVLQSSCLEDKDCGSCGASICLTKTKRCGCSKNFVHN 191
               |....|..|  .|.:.|          ..|:|.....|.: ||| |..:...|.|:..:...
  Rat   685 ---FPGWTGKDCSQACPSGF----------WGSACFHTCSCHN-GAS-CSAEDGACHCTPGWTGL 734

  Fly   192 HNMTKCIKGSAYGDTCEHSSPCKLNLGADGRCLDHL---CVCRS----THYPKRVANEVAKDEND 249
            ....:| ..:.:|..|.|...|:     :|...||:   |.||:    .|..:|           
  Rat   735 FCTQRC-PAAFFGKDCGHICQCQ-----NGASCDHITGKCTCRTGFSGRHCEQR----------- 782

  Fly   250 DLDAVNNLERITCAPIVPFGALCRNDSECRMQPMDQENATASIGHPMVCN--WGECSCSKTHRLE 312
                        ||| ..||..|:...||      ..|||        |:  .|.|.||.     
  Rat   783 ------------CAP-GTFGYGCQQLCEC------MNNAT--------CDHVTGTCYCSP----- 815

  Fly   313 DNKCVFVENSATNYQLRGFVAFLCIQFTMIL 343
                             ||....|.|..:::
  Rat   816 -----------------GFKGIRCDQAALMM 829

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 17/62 (27%)
Megf11XP_038938374.1 EMI 26..93 CDD:400092
EGF_CA 189..234 CDD:419698
Laminin_EGF 275..320 CDD:395007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.