DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11674 and tnfaip6

DIOPT Version :9

Sequence 1:	NP_572948.1	Gene:	CG11674 / 32374	FlyBaseID:	FBgn0030551	Length:	344	Species:	Drosophila melanogaster
Sequence 2:	NP_001035333.2	Gene:	tnfaip6 / 678516	ZFINID:	ZDB-GENE-060421-2654	Length:	271	Species:	Danio rerio

Alignment Length:	143	Identity:	31/143 - (21%)
Similarity:	41/143 - (28%)	Gaps:	56/143 - (39%)

- Green bases have known domain annotations that are detailed below.

  Fly   249 DDLDAVNNLERITCA-----------PIVPFGALC------------------RND--------S 276
            |.|:|...:....||           |||..|:.|                  |.|        .
Zfish    79 DQLEAARQIGFHVCAAGWLDKGRVGYPIVKAGSNCGFGKVGIIDYGYRLNKSERWDVYCYNPVAK 143

  Fly   277 ECRMQPMDQENATASIGHP------MVCNWGECSCSKTHRL----------EDNKCV--FVENSA 323
            ||.....|.|....|.|:|      .:|.| .......||:          ||..|:  .:|...
Zfish   144 ECGGVHTDPEKVLVSPGYPDEYQDEQICYW-HIRVRFGHRIRLHFLDFDIEEDTDCLSDHLEIYD 207

  Fly   324 TNYQLRGFVAFLC 336
            :...:.|||...|
Zfish   208 SYDDVSGFVGRYC 220

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11674	NP_572948.1	EB	96..153	CDD:279949
tnfaip6	NP_001035333.2	Link_domain_TSG_6_like	46..138	CDD:239592	12/58 (21%)
tnfaip6	NP_001035333.2	CUB	145..254	CDD:278839	18/77 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1218
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900