DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and pear1

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_700533.4 Gene:pear1 / 571812 ZFINID:ZDB-GENE-091230-1 Length:1020 Species:Danio rerio


Alignment Length:370 Identity:83/370 - (22%)
Similarity:110/370 - (29%) Gaps:124/370 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LSCSSDAQC-----AQFERGRCVDMACICTARGSGER----VPCTPLEERLKLTNIIGGACPCPM 82
            ::||.|..|     ...|:|:|.     |.|..:|||    .|.....|..|      |.|.| .
Zfish   268 INCSKDCLCHNGGHCDQEKGQCQ-----CDAGYTGERCNEECPVGTYGEDCK------GVCDC-A 320

  Fly    83 PNAICHTRWQQCHCSEGHVSSD-DRRRCLPAVVPVGGSCEFQQQCQRADRFSSCIGNQCLC--LN 144
            ..|.|:.....|.|..|..... |.|.|..||        |...||          ::|||  ||
Zfish   321 NGARCYNIHGGCLCEPGFKGPRCDHRMCPEAV--------FGMHCQ----------HRCLCNPLN 367

  Fly   145 QFEFH--EGRCL----------------SVLQSSCLEDKDCGSCGASICLTKTKRCGCSKNFVHN 191
            ....|  :|.|.                ....:.|||  .|......:|.:.|.:|.|...|...
Zfish   368 TLSCHPLKGECTCQPGWAGLYCNETCAQGYYGNGCLE--PCLCVNGGVCDSVTGQCHCPPGFTGL 430

  Fly   192 HNMTKCIKGSAYGDTCEHSSPCKLNLGADGRCLDHLCVCR--------------STHYPKRVANE 242
            |....|..| .||..|  .|.||.........:|..|:|:              .|..|.  .|.
Zfish   431 HCEKLCEDG-FYGKGC--LSACKCVNSIVCSPVDGACICKEGWRGPDCSIACSEGTWGPG--CNR 490

  Fly   243 VAKDENDDLDAVNNLERITCAP---------------------IVPFGALCRNDSECRMQPMDQE 286
            ..|..|.          .:|.|                     |..||..|:|..:|     ..:
Zfish   491 TCKCTNG----------ASCDPADGSCKCTAGWRGASCDEPCLIGTFGPGCQNQCDC-----VHD 540

  Fly   287 NATASIGHPMVC--NWGECSCSK-----THRLEDNKCVFVENSAT 324
            ....|:....:|  .|....|::     |..::.|:.....||||
Zfish   541 EGCESVTGQCLCLPGWTGVRCTQQCPEGTWGIQCNQTCSCLNSAT 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 17/61 (28%)
pear1XP_700533.4 EMI 29..96 CDD:284877
Laminin_EGF 411..451 CDD:278482 13/42 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.