DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and megf11

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_009291879.1 Gene:megf11 / 563468 ZFINID:ZDB-GENE-060503-252 Length:1114 Species:Danio rerio


Alignment Length:397 Identity:89/397 - (22%)
Similarity:112/397 - (28%) Gaps:148/397 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RAEDLLE-----LSCSSDAQC-----AQFERGRCV----DMACICTARGSGERVP-------CTP 63
            |.|||.|     ..|....||     ...|.|.|:    .|..||     |||.|       |  
Zfish   177 RCEDLCEPGYYGKGCQLQCQCLNGATCHHETGECICAPGYMGPIC-----GERCPSGSHGPQC-- 234

  Fly    64 LEERLKLTNIIGGAC--------------------PCPM--------------PNAICHTRWQQC 94
             |:|....|  ||.|                    |||.              ...:|.....||
Zfish   235 -EQRCPCQN--GGTCHHITGECSCPAGWTGSVCAQPCPFGKYGINCSKECSCRNGGLCDHITGQC 296

  Fly    95 HCSEGHVSSDDRRRCLPAVVPV---GGSCEFQQQCQRADRFSSC--IGNQCLCLNQFEFHEGR-- 152
            .|..|:.....:..|     ||   |..|.....||..   :.|  |...|||...|:.|..:  
Zfish   297 QCMAGYSGHRCQEEC-----PVGTYGPQCTLHCDCQNG---AKCYHINGACLCDTGFKGHHCQDR 353

  Fly   153 -CLSVLQS-SCLEDKDCGSCGASICLTKTKRCGCSKNFVHNHNMTKCIKGSAYGDTCEHSSPCKL 215
             |...|.. .|.:...|.|.....|...|..|.|:..:...:....|..| .||:.|  ..||:.
Zfish   354 FCPPGLYGLICDKYCPCNSTNTISCHPLTGECSCTAGWTGLYCNETCPPG-YYGEGC--GVPCQC 415

  Fly   216 NLGADGRCLDHLCVCRSTHYPKRVANEVAKDENDDLDAVNNLERITCAPIVPFGAL--------- 271
            ..|||...|...|:|...:            ..||           |:...|.|..         
Zfish   416 ANGADCHSLTGACICAPGY------------TGDD-----------CSQTCPSGLFGTNCTSICH 457

  Fly   272 CRNDSECRMQPMDQE-------------------------NATASIGHPMVCN--WGECSCSKTH 309
            |.|.:.|  .|:|..                         |.|....:...|:  .|.|:||...
Zfish   458 CHNQASC--SPIDGSCICKEGWQGVDCSILCSSGTWGLGCNQTCLCANGAACDPIDGSCTCSSGW 520

  Fly   310 RLEDNKC 316
            |.|  :|
Zfish   521 RGE--RC 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 16/64 (25%)
megf11XP_009291879.1 EMI 32..98 CDD:311482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.