DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and megf6b

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_009304569.1 Gene:megf6b / 557764 ZFINID:ZDB-GENE-101112-3 Length:1589 Species:Danio rerio


Alignment Length:368 Identity:86/368 - (23%)
Similarity:116/368 - (31%) Gaps:107/368 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FLATGRAEDLLELSC-----SSDAQCAQFERGRCVDMA--------CICTARGSGER-------- 58
            |..:|......:|.|     .||.|    :|..||:.|        |:|....:|||        
Zfish  1091 FCPSGWTGAACQLECPAGRFGSDCQ----DRCECVNGAQCDGQTGRCVCPPGWTGERCENECERG 1151

  Fly    59 ---VPCTPLEERLK-----LTNIIGGACPCP------------MPNAI---------------CH 88
               |.|   |:|.:     :.:.:.|.|.||            :|.:.               ||
Zfish  1152 WFGVGC---EDRCQCDHGAVCHHVSGQCLCPAGWRGRRCEKACLPGSFGQDCVQRCSCPSGSSCH 1213

  Fly    89 TRWQQCHCSEGHVSSDDRRRCLPAVVPVGGSCEFQQQCQRADRFSSC--IGNQCLCLNQFE--FH 149
            .....|.|:.|.........|||..  .|..|  .|.||.::|...|  :...|.|...|.  ..
Zfish  1214 HVTGHCGCAPGFTGDGCEHSCLPGT--FGQDC--NQVCQCSERNQLCHPVTGVCYCAPGFTGLKC 1274

  Fly   150 EGRCLSVLQSSCLEDKDCGSCGASICLTKTKRCGCSKNFVHNHNMTKCIKGSAYGDTCEHSSPCK 214
            |..|...|..|..|.: |......:||:.:..|.|...|:.......|..| .||..|.|.|.|.
Zfish  1275 EQTCPQGLYGSGCEHQ-CECLNGGVCLSDSGSCQCPAGFIGAQCNQTCPAG-RYGLDCAHVSACG 1337

  Fly   215 L---NLGADGRCLDHLCVCRSTHYPKRVANEVAKDENDDLDAVNNLERITCA------------P 264
            .   |..|.|||..|. ||....:....:...........|.|:.  ..:||            |
Zfish  1338 TGVRNDPATGRCTAHQ-VCPPGWFGSGCSQRCDCSNRGVCDGVSG--NCSCALGWTGKHCDKECP 1399

  Fly   265 IVPFGALCRNDSECRMQPMDQENATASIGHPMVCN--WGECSC 305
            ...||      .:|.:|...|.|:|        |:  .|.|.|
Zfish  1400 DGSFG------PDCSLQCSCQNNST--------CDRVTGSCHC 1428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 16/60 (27%)
megf6bXP_009304569.1 EMI 33..102 CDD:284877
FXa_inhibition 152..187 CDD:291342
vWFA <184..227 CDD:294047
FXa_inhibition 234..270 CDD:291342
FXa_inhibition 276..311 CDD:291342
vWFA <308..350 CDD:294047
FXa_inhibition 363..398 CDD:291342
vWFA <396..436 CDD:294047
FXa_inhibition 445..480 CDD:291342
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.