DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and ccbe1

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001157395.1 Gene:ccbe1 / 555629 ZFINID:ZDB-GENE-090506-7 Length:401 Species:Danio rerio


Alignment Length:217 Identity:50/217 - (23%)
Similarity:78/217 - (35%) Gaps:43/217 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RGRCVDMACICTARGSGERVPCTPLEERLKLTNIIGGACPCPMPNAICHTRWQQCHCSEGHVSSD 104
            ||..:.:|.......||  .|.|..||:..:...:     | ..:.|..|:: .|..|.|.|::.
Zfish     6 RGASLSVAVALVLFSSG--APWTFREEKEDVDREV-----C-SESKIATTKY-PCVKSTGEVTTC 61

  Fly   105 DRRRC-------LPAVVP------VGGSCEFQQQCQRADRFSSCIGNQCLCLNQFEFHEGRCLSV 156
            .|::|       |...:|      .|..||  |||  .|.|...:   |.|.:.:.:...|..:.
Zfish    62 YRKKCCEGFKFVLGQCIPEDYDVCAGAPCE--QQC--TDHFGRVV---CTCYDGYRYDRERHRNR 119

  Fly   157 LQSSCLEDKDCGSCGASIC------LTKTKRCGCSKNFVHNHNMTKCIKGSAYGDTCEHSSPCKL 215
            .:..||:..:|.:...::|      ...:.||.|...|....:...|.||.. ....|.|.    
Zfish   120 EKPYCLDIDECANNNETVCSQMCVNTPGSYRCDCHSGFYLEDDGKTCTKGER-APLFEKSD---- 179

  Fly   216 NLGADGRCLDHLCVCRSTHYPK 237
            |:..:|.|   ...|...|..|
Zfish   180 NVMKEGTC---SATCEDFHQMK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 17/69 (25%)
ccbe1NP_001157395.1 FXa_inhibition 130..166 CDD:291342 6/35 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..321
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.