DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and Dkk3

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001347186.1 Gene:Dkk3 / 50781 MGIID:1354952 Length:366 Species:Mus musculus


Alignment Length:197 Identity:44/197 - (22%)
Similarity:67/197 - (34%) Gaps:79/197 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 IGNQCLCLNQFEFHE------GRCL---SVLQS----------SCLEDKDCGS---CGAS----- 173
            :||..:.::| |.|:      |:.:   :|:.|          .|:.|:|||.   |..|     
Mouse   121 VGNNTVHVHQ-EVHKITNNQSGQVVFSETVITSVGDEEGKRSHECIIDEDCGPTRYCQFSSFKYT 184

  Fly   174 ---------ICLTKTKRCG---CSKNFVHNHNMTKCIKGSAYGDTCEHSSPCKLNLGADGRCLDH 226
                     :|...::.||   |:    ..|...|..|| ..|..|::...|:     .|.|   
Mouse   185 CQPCRDQQMLCTRDSECCGDQLCA----WGHCTQKATKG-GNGTICDNQRDCQ-----PGLC--- 236

  Fly   227 LC---------VCRSTHYPKRVANEVAKDEND--------DLDAVNNLERITCAPIVPFGALCRN 274
             |         ||.    |..|..|:..|...        :|:....|:|..||.    |.||:.
Mouse   237 -CAFQRGLLFPVCT----PLPVEGELCHDPTSQLLDLITWELEPEGALDRCPCAS----GLLCQP 292

  Fly   275 DS 276
            .|
Mouse   293 HS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 6/22 (27%)
Dkk3NP_001347186.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.