DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and CG17147

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:243 Identity:52/243 - (21%)
Similarity:78/243 - (32%) Gaps:75/243 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GSCEFQQQCQRAD-RFSSCIGNQCLCLNQFEFHEGRCLSVLQSSCLEDKDCGSCGASICLTKTKR 181
            |:|:...||...: ...:|..||     .|...:|.|:..|.:|   :|.||:           |
  Fly    45 GTCDQYIQCYDGNGTVLTCPSNQ-----SFNPSKGSCVDTLANS---NKYCGN-----------R 90

  Fly   182 C-GCSKNFVHN----HNMTKCIKGSAYGDTC-------EHSSPCKLNLGADGRCLDHLCVCRSTH 234
            | |....:|.:    |....|:.|......|       |.|..|.  .|.|..|:|...:|... 
  Fly    91 CEGLDGEWVADPTECHKYFYCMNGVPLAGMCPVGQHFDERSQSCL--YGVDSMCVDVNNICELV- 152

  Fly   235 YPKRVANEVAKDEND-----DLDAVNNLERITCAPIVPFGALCRNDSECRMQPMDQENATASIGH 294
                ..|...::|.|     :.|...|                .....|.:....:|......|:
  Fly   153 ----AENTKFRNEKDCAYYYECDKTGN----------------HASKSCTVTSKKREYFDVESGN 197

  Fly   295 PMVCNWGECSCSKTHRLEDNKC------VFVENSATNYQLRGFVAFLC 336
            .:..|..||    |...::|.|      .|..:.||   .||:  |:|
  Fly   198 CVEANKVEC----TAHSKENVCTSSTTMTFKSDQAT---CRGY--FVC 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 9/35 (26%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 9/36 (25%)
ChtBD2 89..136 CDD:214696 11/59 (19%)
CBM_14 278..332 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.