DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and CG5883

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster


Alignment Length:364 Identity:65/364 - (17%)
Similarity:93/364 - (25%) Gaps:163/364 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SCSSDAQCAQFE-----------------RGRC---VDMAC----ICTARGSGERVPCTPLEERL 68
            |||....|..||                 :|.|   .|..|    ||  :|||            
  Fly    49 SCSESIICQNFESTPGITCSGSKPYYSKSKGSCQASADTYCDTSKIC--KGSG------------ 99

  Fly    69 KLTNIIGGACPCPMPNAICHTRWQQCH---------CSEGHVSSDDRRRCLPA------------ 112
              |..||....|        ..|..|.         |:.|.......:.|:.:            
  Fly   100 --TGYIGDTINC--------ANWYYCDADALLGKGTCNLGMYFDQVSKSCVYSEDTVCAAKYEIC 154

  Fly   113 -VVPVG------GSCEFQQQCQRADRFSSCIGNQCLCLNQFEFHEGRCLSVLQSSCLEDKDCGSC 170
             |.|||      .:|.....|..    .|.:.|.|        ..|...:|...:|:..||.   
  Fly   155 DVAPVGTPFRDDANCHKYYTCSS----KSLVENTC--------ENGLYYNVATGTCVRKKDV--- 204

  Fly   171 GASICLTKTKRCGCSKNFVHNHNMTKCIKGSAYGDTCEHSSPCKLNLGADGRCLDHLCVCRSTHY 235
               ||              .||.:...:.|:.             .|....:.:..:..||..:|
  Fly   205 ---IC--------------ENHPLPDEVCGNK-------------KLAVRNKFVSDMATCRGYYY 239

  Fly   236 PKRVANEVAK--------DENDDLDAVNNLERITCAPIVPFGALCRNDSECRMQPMDQENATASI 292
            .:.:.:.:..        |||:..    |.||..|.|        |...:|.....|.......:
  Fly   240 CRDLGSGIPDTDPIYQQCDENNFF----NQERQACMP--------RESQKCDYDRCDGRKDGFEV 292

  Fly   293 GHPMVC-NWGEC---------------------SCSKTH 309
            .....| ::.||                     :||.||
  Fly   293 AEIDGCHHYIECVDGRETTPISCEDKYFDVVTQNCSSTH 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 13/75 (17%)
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 13/74 (18%)
CBM_14 154..204 CDD:279884 13/61 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.