DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11674 and PEAR1

DIOPT Version :9

Sequence 1:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_016856723.1 Gene:PEAR1 / 375033 HGNCID:33631 Length:1125 Species:Homo sapiens


Alignment Length:415 Identity:88/415 - (21%)
Similarity:118/415 - (28%) Gaps:158/415 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GR-AEDLLE-LSCSSDAQCAQ----------FERGRCVDMACICTARGSGERVPCTPLEERLKLT 71
            || .:|..| ..|:.||:|..          |...||.|..|.....|...:.|||...|.....
Human   397 GRFGQDCAETCDCAPDARCFPANGACLCEHGFTGDRCTDRLCPDGFYGLSCQAPCTCDREHSLSC 461

  Fly    72 NIIGGACPCPMP----------------------------NAICHTRWQQCHCSEGHVSSDDRRR 108
            :.:.|.|.| :|                            ..:|......|.|:.|:........
Human   462 HPMNGECSC-LPGWAGLHCNESCPQDTHGPGCQEHCLCLHGGVCQATSGLCQCAPGYTGPHCASL 525

  Fly   109 CLPAVVPVGGSCEFQQQCQRADRFSSCIGNQCLCLNQFEFHEGRCLSVLQSSCLEDKDCGSCGAS 173
            |.|..  .|.:|..:..|:.|...|. |..:|:|...::  .|.| ||   .|.......||.||
Human   526 CPPDT--YGVNCSARCSCENAIACSP-IDGECVCKEGWQ--RGNC-SV---PCPPGTWGFSCNAS 581

  Fly   174 -------ICLTKTKRCGCSKNFVHNHNMTKCIKGSAYGDTCEHSSPCKLNLGAD---GRC----- 223
                   :|..:|..|.|:..:...|....|.||. :|:.|.....|..:.|.|   |||     
Human   582 CQCAHEAVCSPQTGACTCTPGWHGAHCQLPCPKGQ-FGEGCASRCDCDHSDGCDPVHGRCQCQAG 645

  Fly   224 ------------------LDHLCVCRS--THYPKRVANEVAKDENDDLDAVNNLERITCAP---- 264
                              ..:.|.|::  |..|          ||.:         ..|||    
Human   646 WMGARCHLSCPEGLWGVNCSNTCTCKNGGTCLP----------ENGN---------CVCAPGFRG 691

  Fly   265 ---------------IVPFGALCRNDSECRMQPMDQENATASI---------------GHPMVCN 299
                           .||  ..|.|.|.|.     ..|.|...               ||     
Human   692 PSCQRSCQPGRYGKRCVP--CKCANHSFCH-----PSNGTCYCLAGWTGPDCSQPCPPGH----- 744

  Fly   300 WGE-----CSC--SKTHRLEDNKCV 317
            |||     |.|  ..|...:|..|:
Human   745 WGENCAQTCQCHHGGTCHPQDGSCI 769

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11674NP_572948.1 EB 96..153 CDD:279949 13/56 (23%)
PEAR1XP_016856723.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.